Result : O31842
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YozL |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2064540 |
| Right | 2064833 |
| Strand | - |
| Nucleotide Sequence | ATGATGCTAGAACAATTAATACAGCTTAAACAAGATTTGATTGATGGATCAAAAGTTGAAAAGCCATCTTTAGATGACAAACAAATTGATGAGATGGATATTCTCGTTTCTGAGGCATTGGAATTTAATAAAGAGTTGAAATTCAAACTCTTTAACAAGGGATTTGTTGAAAATGTTACCGGCAGAGTACATTACATTAATTTTGAACAACAAAAGCTTCACGTAAAAGACCAGAACGACAATACAGTTTATATCAACATGAATAACATCATAAGAGTTATATACAATGACTGA |
| Sequence | MMLEQLIQLKQDLIDGSKVEKPSLDDKQIDEMDILVSEALEFNKELKFKLFNKGFVENVTGRVHYINFEQQKLHVKDQNDNTVYINMNNIIRVIYND |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam08863. Profile Description: YolD-like protein. Members of this family are functionally uncharacterized. However it has been predicted that these proteins are functionally equivalent to the UmuD subunit of polymerase V from gram-negative bacteria. This family has been shown to belong to the WYL-like superfamily. |
| Pubmed ID | 9384377 |
| Domain | CDD:400980 |
| Functional Category | Others |
| Uniprot ID | O31842 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2064540 | 2064833 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2271650 | 2271943 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 3 | 2005060 | 2005353 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 1723085 | 1723378 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 1822589 | 1822882 | + | NZ_CP051464.1 | Bacillus mojavensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF11798.10 | 1.0 | 4 | -7 | same-strand | IMS family HHH motif |
| 2 | PF00817.22 | 0.75 | 3 | -7 | same-strand | impB/mucB/samB family |
| 3 | PF11799.10 | 0.75 | 3 | -7 | same-strand | impB/mucB/samB family C-terminal domain |
++ More..