Protein Information |
Information Type | Description |
---|---|
Protein name | Phosphatase RapK inhibitor (Phosphatase regulator K) |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 2063262 |
Right | 2063384 |
Strand | + |
Nucleotide Sequence | ATGAAAAAACTTGTGCTTTGCGTATCTATTTTAGCTGTGATTTTAAGTGGAGTAGCTTTAACGCAATTGAGTACAGATTCACCATCTAACATCCAGGTAGCTGAAAGGCCAGTCGGAGGTTAA |
Sequence | MKKLVLCVSILAVILSGVALTQLSTDSPSNIQVAERPVGG |
Source of smORF | Swiss-Prot |
Function | Inhibitor of the activity of phosphatase RapK. |
Pubmed ID | 9384377 |
Domain | CDD:411633 |
Functional Category | Others |
Uniprot ID | O31840 |
ORF Length (Amino Acid) | 40 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2063262 | 2063384 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 2000132 | 2000254 | + | NZ_CP051464.1 | Bacillus mojavensis |
3 | 2046685 | 2046807 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
4 | 1963601 | 1963723 | + | NZ_CP013984.1 | Bacillus inaquosorum |
5 | 763380 | 763502 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
6 | 798541 | 798663 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
7 | 830165 | 830287 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF18801.3 | 0.86 | 6 | -3.0 | same-strand | response regulator aspartate phosphatase H, N terminal |
2 | PF13424.8 | 0.86 | 6 | -3.0 | same-strand | Tetratricopeptide repeat |