Result : O31840
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Phosphatase RapK inhibitor (Phosphatase regulator K) |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2063262 |
| Right | 2063384 |
| Strand | + |
| Nucleotide Sequence | ATGAAAAAACTTGTGCTTTGCGTATCTATTTTAGCTGTGATTTTAAGTGGAGTAGCTTTAACGCAATTGAGTACAGATTCACCATCTAACATCCAGGTAGCTGAAAGGCCAGTCGGAGGTTAA |
| Sequence | MKKLVLCVSILAVILSGVALTQLSTDSPSNIQVAERPVGG |
| Source of smORF | Swiss-Prot |
| Function | Inhibitor of the activity of phosphatase RapK. |
| Pubmed ID | 9384377 |
| Domain | CDD:411633 |
| Functional Category | Others |
| Uniprot ID | O31840 |
| ORF Length (Amino Acid) | 40 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2063262 | 2063384 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2000132 | 2000254 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 3 | 2046685 | 2046807 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 1963601 | 1963723 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 763380 | 763502 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 6 | 798541 | 798663 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 7 | 830165 | 830287 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF18801.3 | 0.86 | 6 | -3.0 | same-strand | response regulator aspartate phosphatase H, N terminal |
| 2 | PF13424.8 | 0.86 | 6 | -3.0 | same-strand | Tetratricopeptide repeat |
++ More..