Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YobB |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 2050689 |
Right | 2050952 |
Strand | + |
Nucleotide Sequence | TTGAAGATTAGGAAAATCTTATTGAGTTCTGCTTTATCCTTTGGCATGCTAATATCCGCGGTTCCCGCATTGGCTGCTGGCACTTCGTCTGAGGTTGCAGTAAAAAATGAAGAATATGATTATGACACTATATACCGCATTAGTCCTCTGCCAATGGACTTCCAGCCAACAATAGAATACAACGGTTATACTTATACGCTTACACGTCATTATTTTGATTACTCAATCGGGTTTTACACGGCTATTTATACAAAAGTTGTTTAA |
Sequence | MKIRKILLSSALSFGMLISAVPALAAGTSSEVAVKNEEYDYDTIYRISPLPMDFQPTIEYNGYTYTLTRHYFDYSIGFYTAIYTKVV |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | O31836 |
ORF Length (Amino Acid) | 87 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2050689 | 2050952 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 2060817 | 2061077 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
3 | 4052752 | 4052967 | - | NZ_CP029364.1 | Bacillus halotolerans |
4 | 88814 | 89029 | + | NZ_CP029364.1 | Bacillus halotolerans |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00892.22 | 1.0 | 2 | 3233.0 | same-strand | EamA-like transporter family |
2 | PF01326.21 | 1.0 | 2 | 1412.0 | opposite-strand | Pyruvate phosphate dikinase, AMP/ATP-binding domain |
3 | PF00391.25 | 1.0 | 2 | 1412.0 | opposite-strand | PEP-utilising enzyme, mobile domain |
4 | PF18801.3 | 1.0 | 2 | 788.0 | same-strand | response regulator aspartate phosphatase H, N terminal |
5 | PF13424.8 | 1.0 | 2 | 788.0 | same-strand | Tetratricopeptide repeat |