Result : O31836

Protein Information

• Protein name: Uncharacterized protein YobB
• NCBI Accession ID: AL009126.3
• Organism: Bacillus subtilis (strain 168)
• Left: 2050689
• Right: 2050952
• Strand: +
• Nucleotide Sequence: TTGAAGATTAGGAAAATCTTATTGAGTTCTGCTTTATCCTTTGGCATGCTAATATCCGCGGTTCCCGCATTGGCTGCTGGCACTTCGTCTGAGGTTGCAGTAAAAAATGAAGAATATGATTATGACACTATATACCGCATTAGTCCTCTGCCAATGGACTTCCAGCCAACAATAGAATACAACGGTTATACTTATACGCTTACACGTCATTATTTTGATTACTCAATCGGGTTTTACACGGCTATTTATACAAAAGTTGTTTAA
• Sequence: MKIRKILLSSALSFGMLISAVPALAAGTSSEVAVKNEEYDYDTIYRISPLPMDFQPTIEYNGYTYTLTRHYFDYSIGFYTAIYTKVV
• Source of smORF: Swiss-Prot
• Pubmed ID: 9384377
• Functional Category: Others
• Uniprot ID: O31836
• ORF Length (Amino Acid): 87

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	2050689	2050952	+	NC_000964.3	Bacillus subtilis subsp. subtilis str. 168
2	2060817	2061077	+	NC_000964.3	Bacillus subtilis subsp. subtilis str. 168
3	4052752	4052967	-	NZ_CP029364.1	Bacillus halotolerans
4	88814	89029	+	NZ_CP029364.1	Bacillus halotolerans

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_CP029364.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00892.22	1.0	2	3233.0	same-strand	EamA-like transporter family
2	PF01326.21	1.0	2	1412.0	opposite-strand	Pyruvate phosphate dikinase, AMP/ATP-binding domain
3	PF00391.25	1.0	2	1412.0	opposite-strand	PEP-utilising enzyme, mobile domain
4	PF18801.3	1.0	2	788.0	same-strand	response regulator aspartate phosphatase H, N terminal
5	PF13424.8	1.0	2	788.0	same-strand	Tetratricopeptide repeat