Result : O31829
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YoaF |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2027509 |
| Right | 2027802 |
| Strand | + |
| Nucleotide Sequence | ATGGACGTTTTTTTAGGAATTGGTATTGCTTTGGCTGGATATTTTATCGGTGAAGGCTTAAAGCAGAGGAACCAAACCAAAGGTAATGAACAAAATGATATCTTCCTAATAAAAGAACGGGATATTTACTTTTACATTGGACTTTTTTTAGGAATAACAACGACTGAAGCAAAACAGTTAGCTGGAGACATGGCAGACCTGCCTTACATCGAAATAAACGGAAAAAAATATGTCCAGAAACATATGTTAAAAGATTGGACATTCACATTAGTTGAAAAACATCAGGGTGAATAA |
| Sequence | MDVFLGIGIALAGYFIGEGLKQRNQTKGNEQNDIFLIKERDIYFYIGLFLGITTTEAKQLAGDMADLPYIEINGKKYVQKHMLKDWTFTLVEKHQGE |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O31829 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2027509 | 2027802 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2044775 | 2045068 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 1947295 | 1947588 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 2033353 | 2033646 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 2145380 | 2145643 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 4091435 | 4091731 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 1962458 | 1962754 | + | NZ_CP051464.1 | Bacillus mojavensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00370.23 | 0.86 | 6 | 3530.0 | opposite-strand | FGGY family of carbohydrate kinases, N-terminal domain |
| 2 | PF02826.21 | 0.86 | 6 | 2511.0 | opposite-strand | D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain |
| 3 | PF00389.32 | 0.71 | 5 | 2512 | opposite-strand | D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain |
| 4 | PF00384.24 | 1.0 | 7 | 110 | same-strand | Molybdopterin oxidoreductase |
| 5 | PF01568.23 | 1.0 | 7 | 110 | same-strand | Molydopterin dinucleotide binding domain |
| 6 | PF04879.18 | 1.0 | 7 | 110 | same-strand | Molybdopterin oxidoreductase Fe4S4 domain |
| 7 | PF13217.8 | 0.71 | 5 | 1218 | same-strand | Protein of unknown function (DUF4025) |
++ More..