Protein Information |
Information Type | Description |
---|---|
Protein name | Aspartyl-phosphate phosphatase YnzD (EC 3.1.3.-) (Stage 0 sporulation regulatory protein YnzD) |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 1922841 |
Right | 1923014 |
Strand | - |
Nucleotide Sequence | GTGATTAGAGAGCATCTATTAAAAGAAATTGAAAAAAAAAGAGCAGAGCTGCTGCAAATTGTCATGGCGAACGGAATGACATCTCATATTACGATAGAGCTCAGTCAGGAGCTTGACCATCTTCTCATACAATATCAAAAGCAGCGCCTTCGAGCAGTAGCGGGTGATGAATGA |
Sequence | MIREHLLKEIEKKRAELLQIVMANGMTSHITIELSQELDHLLIQYQKQRLRAVAGDE |
Source of smORF | Swiss-Prot |
Function | Aspartyl-phosphate phosphatase which specifically dephosphorylates the sporulation transcription factor Spo0A-P and negatively regulates the sporulation initiation pathway in order to control the proper timing of sporulation. {ECO:0000269|Pubmed:11679073}. |
Pubmed ID | 9384377 11679073 |
Domain | CDD:401369 |
Functional Category | Others |
Uniprot ID | O31819 |
ORF Length (Amino Acid) | 57 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1922841 | 1923014 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 1850054 | 1850227 | - | NZ_CP051464.1 | Bacillus mojavensis |
3 | 1886731 | 1886904 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
4 | 47374 | 47547 | + | NZ_CP029364.1 | Bacillus halotolerans |
5 | 2035825 | 2035998 | - | NZ_CP033052.1 | Bacillus vallismortis |
6 | 1831158 | 1831331 | - | NZ_CP013984.1 | Bacillus inaquosorum |
7 | 1884932 | 1885096 | - | NZ_CP048852.1 | Bacillus tequilensis |
8 | 2083720 | 2083893 | + | NZ_CP011937.1 | Bacillus velezensis |
9 | 1871942 | 1872115 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
10 | 2165345 | 2165512 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
11 | 1982123 | 1982287 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
12 | 2032706 | 2032870 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
13 | 3552889 | 3553056 | + | NZ_CP017786.1 | Bacillus xiamenensis |
14 | 1772751 | 1772918 | - | NZ_CP011150.1 | Bacillus altitudinis |
15 | 3542885 | 3543052 | + | NZ_CP043404.1 | Bacillus safensis |
16 | 1044882 | 1045037 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00239.23 | 0.94 | 15 | 3448 | opposite-strand | Resolvase, N terminal domain |
2 | PF05979.14 | 0.94 | 15 | 3151 | opposite-strand | Bacterial protein of unknown function (DUF896) |
3 | PF00456.23 | 0.94 | 15 | 977 | opposite-strand | Transketolase, thiamine diphosphate binding domain |
4 | PF02779.26 | 0.94 | 15 | 977 | opposite-strand | Transketolase, pyrimidine binding domain |
5 | PF02780.22 | 0.94 | 15 | 977 | opposite-strand | Transketolase, C-terminal domain |
6 | PF10747.11 | 0.94 | 15 | 378 | opposite-strand | Sporulation inhibitor of replication protein SirA |
7 | PF03672.15 | 0.94 | 15 | 74 | opposite-strand | Uncharacterised protein family (UPF0154) |
8 | PF02683.17 | 1.0 | 16 | 220.0 | opposite-strand | Cytochrome C biogenesis protein transmembrane region |
9 | PF13386.8 | 0.69 | 11 | 220 | opposite-strand | Cytochrome C biogenesis protein transmembrane region |
10 | PF00072.26 | 0.81 | 13 | 1016 | opposite-strand | Response regulator receiver domain |
11 | PF07301.13 | 1.0 | 16 | 1466.0 | opposite-strand | Protein of unknown function (DUF1453) |
12 | PF11084.10 | 1.0 | 16 | 1979.0 | same-strand | Protein of unknown function (DUF2621) |