Result : O31819

Protein Information

• Protein name: Aspartyl-phosphate phosphatase YnzD (EC 3.1.3.-) (Stage 0 sporulation regulatory protein YnzD)
• NCBI Accession ID: AL009126.3
• Organism: Bacillus subtilis (strain 168)
• Left: 1922841
• Right: 1923014
• Strand: -
• Nucleotide Sequence: GTGATTAGAGAGCATCTATTAAAAGAAATTGAAAAAAAAAGAGCAGAGCTGCTGCAAATTGTCATGGCGAACGGAATGACATCTCATATTACGATAGAGCTCAGTCAGGAGCTTGACCATCTTCTCATACAATATCAAAAGCAGCGCCTTCGAGCAGTAGCGGGTGATGAATGA
• Sequence: MIREHLLKEIEKKRAELLQIVMANGMTSHITIELSQELDHLLIQYQKQRLRAVAGDE
• Source of smORF: Swiss-Prot
• Function: Aspartyl-phosphate phosphatase which specifically dephosphorylates the sporulation transcription factor Spo0A-P and negatively regulates the sporulation initiation pathway in order to control the proper timing of sporulation. {ECO:0000269|Pubmed:11679073}.
• Pubmed ID: 9384377 11679073
• Domain: CDD:401369
• Functional Category: Others
• Uniprot ID: O31819
• ORF Length (Amino Acid): 57

Conservation Analysis

No. of Species: 16

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	1922841	1923014	-	NC_000964.3	Bacillus subtilis subsp. subtilis str. 168
2	1850054	1850227	-	NZ_CP051464.1	Bacillus mojavensis
3	1886731	1886904	-	NZ_CP034943.1	Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499
4	47374	47547	+	NZ_CP029364.1	Bacillus halotolerans
5	2035825	2035998	-	NZ_CP033052.1	Bacillus vallismortis
6	1831158	1831331	-	NZ_CP013984.1	Bacillus inaquosorum
7	1884932	1885096	-	NZ_CP048852.1	Bacillus tequilensis
8	2083720	2083893	+	NZ_CP011937.1	Bacillus velezensis
9	1871942	1872115	-	NZ_CP053376.1	Bacillus amyloliquefaciens
10	2165345	2165512	-	NZ_LT603683.1	Bacillus glycinifermentans
11	1982123	1982287	-	NC_006270.3	Bacillus licheniformis DSM 13 = ATCC 14580
12	2032706	2032870	-	NZ_CP023665.1	Bacillus paralicheniformis
13	3552889	3553056	+	NZ_CP017786.1	Bacillus xiamenensis
14	1772751	1772918	-	NZ_CP011150.1	Bacillus altitudinis
15	3542885	3543052	+	NZ_CP043404.1	Bacillus safensis
16	1044882	1045037	+	NZ_CP068053.1	Peribacillus psychrosaccharolyticus

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_000964.3

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00239.23	0.94	15	3448	opposite-strand	Resolvase, N terminal domain
2	PF05979.14	0.94	15	3151	opposite-strand	Bacterial protein of unknown function (DUF896)
3	PF00456.23	0.94	15	977	opposite-strand	Transketolase, thiamine diphosphate binding domain
4	PF02779.26	0.94	15	977	opposite-strand	Transketolase, pyrimidine binding domain
5	PF02780.22	0.94	15	977	opposite-strand	Transketolase, C-terminal domain
6	PF10747.11	0.94	15	378	opposite-strand	Sporulation inhibitor of replication protein SirA
7	PF03672.15	0.94	15	74	opposite-strand	Uncharacterised protein family (UPF0154)
8	PF02683.17	1.0	16	220.0	opposite-strand	Cytochrome C biogenesis protein transmembrane region
9	PF13386.8	0.69	11	220	opposite-strand	Cytochrome C biogenesis protein transmembrane region
10	PF00072.26	0.81	13	1016	opposite-strand	Response regulator receiver domain
11	PF07301.13	1.0	16	1466.0	opposite-strand	Protein of unknown function (DUF1453)
12	PF11084.10	1.0	16	1979.0	same-strand	Protein of unknown function (DUF2621)