Result : O31807
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YnzB |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1907013 |
| Right | 1907201 |
| Strand | + |
| Nucleotide Sequence | ATGCTTGGAAAAATCAAAGCAGCCATTGATAATAGTCCAGGGAAGCCGGCCAGAATTTTAGTTAGTGAAAAAGCGTTTCAGCAATTAGAGGAAGAAATGCGCTTTGTTTACGTTTCCAAACCGAAAACGATAATGGGGATTCCTGTGGAAGTTTCAGATCAGGCAGAAAGCTTCAAGCTGGAATTTTAG |
| Sequence | MLGKIKAAIDNSPGKPARILVSEKAFQQLEEEMRFVYVSKPKTIMGIPVEVSDQAESFKLEF |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 19383706 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O31807 |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1907013 | 1907201 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1814065 | 1814253 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 1875054 | 1875242 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 2018343 | 2018531 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 1873054 | 1873242 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 6 | 1837525 | 1837713 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 59798 | 59986 | - | NZ_CP029364.1 | Bacillus halotolerans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02416.18 | 0.71 | 5 | 1525 | opposite-strand | mttA/Hcf106 family |
| 2 | PF08327.13 | 0.71 | 5 | 394 | opposite-strand | Activator of Hsp90 ATPase homolog 1-like protein |
++ More..