Result : A1WX38
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein RnfH |
| NCBI Accession ID | CP000544.1 |
| Organism | Halorhodospira halophila (strain DSM 244 / SL1) (Ectothiorhodospira halophila (strain DSM 244 / SL1)) |
| Left | 1604019 |
| Right | 1604312 |
| Strand | - |
| Nucleotide Sequence | ATGTCCTCTGAGGGGGAGCTGGGGATCGAGGTCGTCTACGCGCTGCCGGGGCAGCAGACGGTGTTGCGGGTCGAGTTGCCGGCCGGCAGCACGGCGGGAGACGCCCTGAACGCCTCCGGAGTGCTGGAGCGCCACCCGGAGATCGATCTGACGCGGCAGTCGGTCGGCGTGTTCGGGCAGATCGTCGGTCTTGATACCCCGTTGCACAATGGTGACCGCGTAGAGGTGTACCGGCCGCTGCAGGTGGATCCGAAAGAGGCCCGCAAGCGGCGTGCCGCCCGCAAGGCCTCCTGA |
| Sequence | MSSEGELGIEVVYALPGQQTVLRVELPAGSTAGDALNASGVLERHPEIDLTRQSVGVFGQIVGLDTPLHNGDRVEVYRPLQVDPKEARKRRAARKAS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl28922. Profile Description: Beta-grasp ubiquitin-like fold. This domain is the binding/interacting region of several protein kinases, such as the Schizosaccharomyces pombe Byr2. Byr2 is a Ser/Thr-specific protein kinase acting as mediator of signals for sexual differentiation in S. pombe by initiating a MAPK module, which is a highly conserved element in eukaryotes. Byr2 is activated by interacting with Ras, which then translocates the molecule to the plasma membrane. Ras proteins are key elements in intracellular signaling and are involved in a variety of vital processes such as DNA transcription, growth control, and differentiation. They function like molecular switches cycling between GTP-bound 'on' and GDP-bound 'off' states. |
| Pubmed ID | |
| Domain | CDD:421700 |
| Functional Category | Others |
| Uniprot ID | A1WX38 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 73
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1604019 | 1604312 | - | NC_008789.1 | Halorhodospira halophila SL1 |
| 2 | 772494 | 772736 | - | NZ_AP017372.2 | Halorhodospira halochloris |
| 3 | 1048001 | 1048282 | + | NZ_AP018150.1 | Mycoavidus cysteinexigens |
| 4 | 2591894 | 2592151 | - | NZ_CP011568.3 | Pandoraea thiooxydans |
| 5 | 1741481 | 1741750 | + | NZ_CP022579.1 | Oryzomicrobium terrae |
| 6 | 571541 | 571837 | + | NZ_CP012418.1 | Kangiella sediminilitoris |
| 7 | 1410166 | 1410480 | + | NC_014722.1 | Mycetohabitans rhizoxinica HKI 454 |
| 8 | 2091596 | 2091889 | - | NZ_LR778301.1 | Denitratisoma oestradiolicum |
| 9 | 828437 | 828715 | + | NZ_CP017561.1 | Paraburkholderia sprentiae WSM5005 |
| 10 | 2839683 | 2840003 | + | NZ_CP022989.1 | Paraburkholderia aromaticivorans |
| 11 | 936331 | 936567 | - | NC_021291.1 | Spiribacter salinus M19-40 |
| 12 | 2465019 | 2465276 | - | NZ_CP040449.1 | Aeromonas simiae |
| 13 | 1204432 | 1204725 | + | NZ_CP017415.1 | Acidihalobacter yilgarnenesis |
| 14 | 2507726 | 2507989 | + | NZ_CP023706.1 | Edwardsiella tarda |
| 15 | 1451977 | 1452240 | + | NZ_CP046913.1 | Paraburkholderia acidisoli |
| 16 | 3024050 | 3024370 | - | NC_007951.1 | Paraburkholderia xenovorans LB400 |
| 17 | 1678705 | 1678971 | - | NZ_AP012273.1 | Thiolapillus brandeum |
| 18 | 1503864 | 1504136 | - | NZ_CP041335.1 | Chitinolyticbacter meiyuanensis |
| 19 | 810777 | 811040 | + | NZ_CP016043.1 | Edwardsiella hoshinae |
| 20 | 2013827 | 2014147 | - | NZ_AP012547.1 | Sulfuritalea hydrogenivorans sk43H |
| 21 | 459844 | 460164 | - | NZ_CP031467.1 | Paraburkholderia caffeinilytica |
| 22 | 2330148 | 2330480 | - | NZ_CP024941.1 | Paraburkholderia terricola |
| 23 | 2960970 | 2961230 | - | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 24 | 1081620 | 1081856 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 25 | 2743461 | 2743724 | - | NC_010681.1 | Paraburkholderia phytofirmans PsJN |
| 26 | 319406 | 319654 | + | NZ_CP058952.1 | Chitinibacter fontanus |
| 27 | 4238227 | 4238481 | - | NZ_CP059467.1 | Aromatoleum bremense |
| 28 | 664964 | 665227 | + | NZ_CP066075.1 | Paraburkholderia ginsengisoli |
| 29 | 863180 | 863440 | - | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 30 | 2270358 | 2270627 | - | NZ_CP029822.1 | Entomomonas moraniae |
| 31 | 2710632 | 2710898 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 32 | 1107245 | 1107574 | + | NZ_AP018724.1 | Sulfurivermis fontis |
| 33 | 2482152 | 2482394 | - | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 34 | 2847341 | 2847691 | - | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
| 35 | 942522 | 942851 | + | NZ_CP010554.1 | Rugosibacter aromaticivorans |
| 36 | 3268142 | 3268399 | - | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
| 37 | 3542619 | 3542870 | - | NZ_CP046293.1 | Yersinia intermedia |
| 38 | 1042718 | 1043038 | + | NC_011901.1 | Thioalkalivibrio sulfidiphilus HL-EbGr7 |
| 39 | 1542723 | 1542983 | + | NC_006513.1 | Aromatoleum aromaticum EbN1 |
| 40 | 3940650 | 3940904 | - | NC_006513.1 | Aromatoleum aromaticum EbN1 |
| 41 | 3804974 | 3805225 | + | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 42 | 648577 | 648837 | - | NC_015572.1 | Methylomonas methanica MC09 |
| 43 | 1876803 | 1877072 | + | NZ_AP017928.1 | Methylocaldum marinum |
| 44 | 700357 | 700623 | + | NZ_LR699114.1 | Aquicella lusitana |
| 45 | 1352720 | 1352992 | + | NZ_CP064781.1 | Azospira restricta |
| 46 | 4552782 | 4553066 | + | NZ_CP059560.1 | Aromatoleum petrolei |
| 47 | 2080519 | 2080794 | + | NZ_CP039268.1 | Thermochromatium tepidum ATCC 43061 |
| 48 | 1674746 | 1675012 | + | NZ_CP029331.1 | Thauera hydrothermalis |
| 49 | 2808846 | 2809124 | + | NC_002977.6 | Methylococcus capsulatus str. Bath |
| 50 | 1710045 | 1710308 | - | NZ_CP009787.1 | Yersinia rohdei |
| 51 | 2174063 | 2174299 | - | NC_008340.1 | Alkalilimnicola ehrlichii MLHE-1 |
| 52 | 1123040 | 1123324 | + | NZ_CP011118.1 | Yersinia enterocolitica |
| 53 | 3521827 | 3522069 | - | NZ_CP042220.2 | Dickeya poaceiphila |
| 54 | 905001 | 905267 | + | NZ_CP023525.1 | Cedecea neteri |
| 55 | 3062377 | 3062661 | + | NZ_CP007230.1 | Yersinia similis |
| 56 | 3489903 | 3490187 | - | NZ_CP032487.1 | Yersinia hibernica |
| 57 | 1154983 | 1155267 | + | NZ_CP043727.1 | Yersinia canariae |
| 58 | 1749075 | 1749353 | - | NZ_CP017707.1 | Chromobacterium vaccinii |
| 59 | 1783135 | 1783455 | + | NZ_CP064338.1 | Schlegelella thermodepolymerans |
| 60 | 1328844 | 1329146 | - | NZ_CP028339.1 | Thauera aromatica K172 |
| 61 | 3757703 | 3757942 | - | NC_005085.1 | Chromobacterium violaceum ATCC 12472 |
| 62 | 1194703 | 1194972 | + | NC_017554.1 | Pantoea ananatis PA13 |
| 63 | 2610638 | 2610922 | - | NZ_CP029185.2 | Limnobaculum parvum |
| 64 | 3037563 | 3037844 | + | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 65 | 4563971 | 4564234 | - | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 66 | 1849930 | 1850196 | - | NC_006526.2 | Zymomonas mobilis subsp. mobilis ZM4 = ATCC 31821 |
| 67 | 882369 | 882611 | + | NZ_CP031560.1 | Dickeya dianthicola |
| 68 | 1106118 | 1106378 | + | NZ_LR134531.1 | Pragia fontium |
| 69 | 2509266 | 2509508 | - | NZ_AP014936.1 | Sulfurifustis variabilis |
| 70 | 2721872 | 2722204 | - | NZ_CP013189.1 | Pseudohongiella spirulinae |
| 71 | 2950187 | 2950471 | + | NZ_CP043929.1 | Methylomonas rhizoryzae |
| 72 | 1432808 | 1433053 | + | NC_017033.1 | Frateuria aurantia DSM 6220 |
| 73 | 1388585 | 1388830 | - | NC_007614.1 | Nitrosospira multiformis ATCC 25196 |
| 74 | 1745885 | 1746175 | + | NC_008825.1 | Methylibium petroleiphilum PM1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_008789.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03364.22 | 0.88 | 64 | 20.0 | same-strand | Polyketide cyclase / dehydrase and lipid transport |
| 2 | PF10604.11 | 0.86 | 63 | 20.0 | same-strand | Polyketide cyclase / dehydrase and lipid transport |
| 3 | PF01668.20 | 0.86 | 63 | 610 | opposite-strand | SmpB protein |
++ More..