Result : O31804
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatAc |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1905370 |
| Right | 1905558 |
| Strand | - |
| Nucleotide Sequence | ATGGAATTAAGCTTCACAAAAATACTCGTTATTTTGTTTGTGGGTTTTTTAGTATTTGGGCCTGATAAACTGCCGGCGCTTGGCCGTGCAGCAGGAAAAGCCTTATCAGAATTTAAACAAGCAACAAGCGGACTGACTCAGGATATCAGAAAAAATGACTCAGAAAACAAAGAAGACAAACAAATGTAG |
| Sequence | MELSFTKILVILFVGFLVFGPDKLPALGRAAGKALSEFKQATSGLTQDIRKNDSENKEDKQM |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | 9384377 11007775 |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | O31804 |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 14
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1905370 | 1905558 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1812352 | 1812540 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 601442 | 601615 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 1873574 | 1873762 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 61662 | 61850 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 1835695 | 1835883 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 637074 | 637247 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 8 | 979971 | 980144 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 9 | 312156 | 312326 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 10 | 753127 | 753288 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 11 | 624432 | 624611 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 12 | 586522 | 586719 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 13 | 3923949 | 3924110 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 14 | 1218660 | 1218842 | - | NZ_CP013661.2 | Planococcus kocurii |
| 15 | 546715 | 546897 | + | NZ_CP019401.1 | Planococcus faecalis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013984.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 0.64 | 9 | 1325.5 | opposite-strand | ABC transporter |
| 2 | PF00902.20 | 0.64 | 9 | 16 | same-strand | Sec-independent protein translocase protein (TatC) |
++ More..