Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YmzA |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 1868144 |
Right | 1868374 |
Strand | + |
Nucleotide Sequence | ATGAAGCATAAAGTGATCGTGAATCATTGGGAAGAAATTTGCGAAGATGATTCTTGCTATGAATACGGAACAAGTATCATTGTGAACGGAAAAGAATTAATCAGAGAAGCGTCAATTATCACTGCTTTGAAGGCGGTTTTAGAAGAGATCGGCGCGGATGTTGAAATAGAAGAAACAGTAGAGAGCGAAAAATGCTGTGATAGCTTAAGAAAAAAAAATCTAGACTACTAA |
Sequence | MKHKVIVNHWEEICEDDSCYEYGTSIIVNGKELIREASIITALKAVLEEIGADVEIEETVESEKCCDSLRKKNLDY |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | O31798 |
ORF Length (Amino Acid) | 76 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1868144 | 1868374 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 1767641 | 1767871 | + | NZ_CP013984.1 | Bacillus inaquosorum |
3 | 1836877 | 1837107 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
4 | 1978114 | 1978344 | + | NZ_CP033052.1 | Bacillus vallismortis |
5 | 108771 | 109001 | - | NZ_CP029364.1 | Bacillus halotolerans |
6 | 1804823 | 1805053 | + | NZ_CP051464.1 | Bacillus mojavensis |
7 | 1701839 | 1702069 | + | NZ_CP048852.1 | Bacillus tequilensis |
8 | 2139771 | 2139986 | - | NZ_CP011937.1 | Bacillus velezensis |
9 | 1823360 | 1823575 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
10 | 2100519 | 2100731 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
11 | 1953310 | 1953522 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
12 | 1920365 | 1920577 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
13 | 3623704 | 3623916 | - | NZ_CP017786.1 | Bacillus xiamenensis |
14 | 1710565 | 1710777 | + | NZ_CP011150.1 | Bacillus altitudinis |
15 | 3596899 | 3597111 | - | NZ_CP043404.1 | Bacillus safensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01715.19 | 1.0 | 15 | 808 | same-strand | IPP transferase |
2 | PF17209.5 | 1.0 | 15 | 547 | same-strand | Hfq protein |
3 | PF14157.8 | 0.8 | 12 | 82.0 | same-strand | YmzC-like protein |
4 | PF02867.17 | 1.0 | 15 | 601 | same-strand | Ribonucleotide reductase, barrel domain |
5 | PF08343.12 | 1.0 | 15 | 601 | same-strand | Ribonucleotide reductase N-terminal |
6 | PF00317.23 | 1.0 | 15 | 601 | same-strand | Ribonucleotide reductase, all-alpha domain |
7 | PF00268.23 | 1.0 | 15 | 2716 | same-strand | Ribonucleotide reductase, small chain |
8 | PF01520.20 | 0.8 | 12 | 4439.0 | opposite-strand | N-acetylmuramoyl-L-alanine amidase |
9 | PF05036.15 | 0.8 | 12 | 4439.0 | opposite-strand | SPOR domain |
10 | PF07972.13 | 0.93 | 14 | 246.5 | same-strand | NrdI Flavodoxin like |