Result : O31798
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YmzA |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1868144 |
| Right | 1868374 |
| Strand | + |
| Nucleotide Sequence | ATGAAGCATAAAGTGATCGTGAATCATTGGGAAGAAATTTGCGAAGATGATTCTTGCTATGAATACGGAACAAGTATCATTGTGAACGGAAAAGAATTAATCAGAGAAGCGTCAATTATCACTGCTTTGAAGGCGGTTTTAGAAGAGATCGGCGCGGATGTTGAAATAGAAGAAACAGTAGAGAGCGAAAAATGCTGTGATAGCTTAAGAAAAAAAAATCTAGACTACTAA |
| Sequence | MKHKVIVNHWEEICEDDSCYEYGTSIIVNGKELIREASIITALKAVLEEIGADVEIEETVESEKCCDSLRKKNLDY |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O31798 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1868144 | 1868374 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1767641 | 1767871 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 1836877 | 1837107 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 1978114 | 1978344 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 108771 | 109001 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 1804823 | 1805053 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 1701839 | 1702069 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 2139771 | 2139986 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 1823360 | 1823575 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 2100519 | 2100731 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 1953310 | 1953522 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 1920365 | 1920577 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 13 | 3623704 | 3623916 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 14 | 1710565 | 1710777 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 15 | 3596899 | 3597111 | - | NZ_CP043404.1 | Bacillus safensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013984.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01715.19 | 1.0 | 15 | 808 | same-strand | IPP transferase |
| 2 | PF17209.5 | 1.0 | 15 | 547 | same-strand | Hfq protein |
| 3 | PF14157.8 | 0.8 | 12 | 82.0 | same-strand | YmzC-like protein |
| 4 | PF02867.17 | 1.0 | 15 | 601 | same-strand | Ribonucleotide reductase, barrel domain |
| 5 | PF08343.12 | 1.0 | 15 | 601 | same-strand | Ribonucleotide reductase N-terminal |
| 6 | PF00317.23 | 1.0 | 15 | 601 | same-strand | Ribonucleotide reductase, all-alpha domain |
| 7 | PF00268.23 | 1.0 | 15 | 2716 | same-strand | Ribonucleotide reductase, small chain |
| 8 | PF01520.20 | 0.8 | 12 | 4439.0 | opposite-strand | N-acetylmuramoyl-L-alanine amidase |
| 9 | PF05036.15 | 0.8 | 12 | 4439.0 | opposite-strand | SPOR domain |
| 10 | PF07972.13 | 0.93 | 14 | 246.5 | same-strand | NrdI Flavodoxin like |
++ More..