| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YmzC |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1867790 |
| Right | 1868062 |
| Strand | + |
| Nucleotide Sequence | TTGTTTGAAAGTGAAGCAGAACTGAGACGAATCAGGATTGCACTTGTATGGATAGCTGTCTTTTTACTGTTCGGGGCGTGCGGGAATCAAGATACCATTATTGAAACAGACAACGGCAATTCAGACTATGAAACGCCTCAGCCCACCTCGTTTCCACTTGAACATAACCATTTTGGCGTTATGGAGGACGGCTATATCAAAATTTATGAGTATAATGAGTCCCGCAATGAGGTAAAGCTGAAGAAAGAATACGCGGATGATGAGCTTGAATAA |
| Sequence | MFESEAELRRIRIALVWIAVFLLFGACGNQDTIIETDNGNSDYETPQPTSFPLEHNHFGVMEDGYIKIYEYNESRNEVKLKKEYADDELE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam14157. Profile Description: YmzC-like protein. The YmzC-like protein family includes the B. subtilis YmzC protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 58 and 91 amino acids in length. There is a conserved ELR sequence motif. |
| Pubmed ID | 9384377 |
| Domain | CDD:404945 |
| Functional Category | Others |
| Uniprot ID | O31797 |
| ORF Length (Amino Acid) | 90 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1867790 | 1868062 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1836523 | 1836795 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 1767287 | 1767559 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 1977762 | 1978034 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 1701485 | 1701757 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 109083 | 109355 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 1804469 | 1804741 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 2140069 | 2140344 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 1823002 | 1823277 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00893.21 | 0.78 | 7 | 2394 | opposite-strand | Small Multidrug Resistance protein |
| 2 | PF01715.19 | 1.0 | 9 | 456 | same-strand | IPP transferase |
| 3 | PF17209.5 | 1.0 | 9 | 195 | same-strand | Hfq protein |
| 4 | PF02867.17 | 1.0 | 9 | 908 | same-strand | Ribonucleotide reductase, barrel domain |
| 5 | PF08343.12 | 1.0 | 9 | 908 | same-strand | Ribonucleotide reductase N-terminal |
| 6 | PF00317.23 | 1.0 | 9 | 908 | same-strand | Ribonucleotide reductase, all-alpha domain |
| 7 | PF00268.23 | 1.0 | 9 | 3028 | same-strand | Ribonucleotide reductase, small chain |
| 8 | PF07972.13 | 0.89 | 8 | 556.0 | same-strand | NrdI Flavodoxin like |