Result : O31768
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YmfJ |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1760464 |
| Right | 1760721 |
| Strand | + |
| Nucleotide Sequence | ATGTCAGTATTAGAAAACTGGGATAGCTGGAAAAACTTCCTTGGCGACCGTCTGAACTATGCGCAAGATAAAGGTATGAGCCAGGATACGATTACAGATCTTGCGACAGAAATCGGCAGCTACTTGGCTAATGAAGTGGAATCTAAGAACGAGCAGGAAAAAGTGCTGGCAGATCTTTGGAGTGTAGCATCAAAAGATGAACAGCACGCCATTGCCAATATGATGGTTAAGCTTGTTGAAAATAACAGCACTCACTAG |
| Sequence | MSVLENWDSWKNFLGDRLNYAQDKGMSQDTITDLATEIGSYLANEVESKNEQEKVLADLWSVASKDEQHAIANMMVKLVENNSTH |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam11588. Profile Description: Protein of unknown function (DUF3243). This family of proteins with unknown function appears to be restricted to Firmicutes. |
| Pubmed ID | 9384377 |
| Domain | CDD:378681 |
| Functional Category | Others |
| Uniprot ID | O31768 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 81
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1760464 | 1760721 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1733383 | 1733640 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 1728335 | 1728592 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 1668081 | 1668338 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 1939331 | 1939588 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 1764675 | 1764932 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 225363 | 225620 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 1718669 | 1718926 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 2242195 | 2242452 | - | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 23457 | 23714 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 11 | 1676589 | 1676846 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 12 | 3631765 | 3632022 | - | NZ_CP043404.1 | Bacillus safensis |
| 13 | 1873380 | 1873637 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 14 | 1896028 | 1896285 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 15 | 2038568 | 2038825 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 16 | 1789022 | 1789279 | - | NZ_CP012024.1 | Bacillus smithii |
| 17 | 2576979 | 2577236 | - | NZ_LS483476.1 | Lederbergia lentus |
| 18 | 2480749 | 2481006 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 19 | 3898268 | 3898528 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 20 | 2271584 | 2271841 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 21 | 1766025 | 1766282 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 22 | 233571 | 233831 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 23 | 2473804 | 2474061 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 24 | 2270788 | 2271045 | + | NZ_CP053989.1 | Niallia circulans |
| 25 | 1145207 | 1145464 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 26 | 1864240 | 1864503 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 27 | 3310557 | 3310814 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 28 | 863478 | 863735 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 29 | 4866536 | 4866796 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 30 | 1647413 | 1647673 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 31 | 1752580 | 1752837 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 32 | 4329829 | 4330086 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 33 | 2253796 | 2254047 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 34 | 2164672 | 2164932 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 35 | 2099378 | 2099638 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 36 | 2358659 | 2358919 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 37 | 1363136 | 1363396 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 38 | 3497769 | 3498026 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 39 | 52749 | 52994 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 40 | 2634804 | 2635052 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 41 | 2510478 | 2510732 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 42 | 1266342 | 1266590 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 43 | 1563988 | 1564236 | + | NZ_CP040336.1 | Bacillus luti |
| 44 | 555656 | 555904 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 45 | 3800329 | 3800577 | - | NC_011725.1 | Bacillus cereus B4264 |
| 46 | 1523720 | 1523968 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 47 | 515623 | 515871 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 48 | 2521523 | 2521771 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 49 | 1780640 | 1780900 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 50 | 3595657 | 3595905 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 51 | 3622943 | 3623191 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 52 | 3804493 | 3804741 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 53 | 3210714 | 3210974 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 54 | 1985832 | 1986089 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 55 | 1455371 | 1455622 | - | NZ_CP034118.1 | Staphylospora marina |
| 56 | 1152764 | 1152976 | + | NZ_CP033433.1 | Cohnella candidum |
| 57 | 2006564 | 2006818 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 58 | 3641563 | 3641820 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 59 | 204083 | 204361 | - | NZ_AP021853.1 | Sporolactobacillus terrae |
| 60 | 1658959 | 1659207 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 61 | 537580 | 537837 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 62 | 1308266 | 1308514 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 63 | 394517 | 394765 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 64 | 2674556 | 2674804 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 65 | 757995 | 758243 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 66 | 3814336 | 3814590 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 67 | 2484593 | 2484856 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 68 | 710559 | 710807 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 69 | 1893034 | 1893282 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 70 | 1180469 | 1180717 | + | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 71 | 1148482 | 1148739 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 72 | 3524443 | 3524700 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 73 | 2698957 | 2699205 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 74 | 135471 | 135719 | + | NZ_CP021434.1 | Tumebacillus avium |
| 75 | 2061895 | 2062143 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 76 | 3682148 | 3682399 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 77 | 2461446 | 2461694 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 78 | 1935304 | 1935567 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 79 | 1369603 | 1369857 | + | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 80 | 1799918 | 1800172 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 81 | 2902416 | 2902625 | + | NZ_CP048209.1 | Paenibacillus lycopersici |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013984.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05193.23 | 0.96 | 78 | 2072.0 | same-strand | Peptidase M16 inactive domain |
| 2 | PF13561.8 | 0.95 | 77 | 76 | same-strand | Enoyl-(Acyl carrier protein) reductase |
| 3 | PF00106.27 | 0.95 | 77 | 76 | same-strand | short chain dehydrogenase |
| 4 | PF08659.12 | 0.95 | 77 | 76 | same-strand | KR domain |
| 5 | PF13413.8 | 0.94 | 76 | 997.5 | same-strand | Helix-turn-helix domain |
| 6 | PF12844.9 | 0.94 | 76 | 995 | same-strand | Helix-turn-helix domain |
| 7 | PF13560.8 | 0.7 | 57 | 972 | same-strand | Helix-turn-helix domain |
| 8 | PF01066.23 | 0.93 | 75 | 1956 | same-strand | CDP-alcohol phosphatidyltransferase |
| 9 | PF02464.19 | 0.85 | 69 | 2561 | same-strand | Competence-damaged protein |
| 10 | PF00994.26 | 0.86 | 70 | 2561.5 | same-strand | Probable molybdopterin binding domain |
| 11 | PF18146.3 | 0.86 | 70 | 2561.5 | same-strand | Damage-inducible protein CinA KH domain |
| 12 | PF11868.10 | 0.94 | 76 | 171.0 | same-strand | Protein of unknown function (DUF3388) |
| 13 | PF00154.23 | 0.62 | 50 | 4004.0 | same-strand | recA bacterial DNA recombination protein |
| 14 | PF08423.13 | 0.62 | 50 | 4004.0 | same-strand | Rad51 |
++ More..