Result : O31729
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein YlmG |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1611321 |
| Right | 1611593 |
| Strand | + |
| Nucleotide Sequence | ATGATCCTTTATCAAGTTTTTTCGGTTTTAAGCTTATTAATCACAATATACTCATTTGCCCTGATCATATATATTTTTATGTCATGGGTGCCGAGTACGAGGGAAACAGCAGTCGGGCGTTTTTTGGCTTCGATTTGTGAACCATATCTCGAACCATTCAGAAAAATCATCCCTCCGATTGCAATGCTGGATATTTCACCAATCGTAGCAATACTTGTGCTTCGGTTTGCGACAACCGGCTTGTGGGGACTTTATCGCATGATTGCGTTTTAA |
| Sequence | MILYQVFSVLSLLITIYSFALIIYIFMSWVPSTRETAVGRFLASICEPYLEPFRKIIPPIAMLDISPIVAILVLRFATTGLWGLYRMIAF |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00508. Profile Description: YGGT family. This family consists of a repeat found in conserved hypothetical integral membrane proteins. The function of this region and the proteins which possess it is unknown. |
| Pubmed ID | 9384377 |
| Domain | CDD:412415 |
| Functional Category | Others |
| Uniprot ID | O31729 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 122
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1518711 | 1518983 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 2 | 1577863 | 1578135 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 1584191 | 1584463 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 374561 | 374833 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 5 | 1611321 | 1611593 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 6 | 1615399 | 1615671 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 1789681 | 1789953 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 8 | 2395141 | 2395419 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 1565730 | 1566008 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 185901 | 186182 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 11 | 1513263 | 1513544 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 12 | 1737157 | 1737393 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 13 | 18897 | 19178 | - | NZ_CP043404.1 | Bacillus safensis |
| 14 | 1739333 | 1739602 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 15 | 1716680 | 1716949 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 16 | 985047 | 985319 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 17 | 552952 | 553221 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 18 | 2844956 | 2845204 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 19 | 1737711 | 1737950 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 20 | 1696164 | 1696427 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 21 | 4046385 | 4046624 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 22 | 1998209 | 1998451 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 23 | 1493956 | 1494231 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 24 | 3969712 | 3969975 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 25 | 1297705 | 1297947 | + | NZ_CP012024.1 | Bacillus smithii |
| 26 | 5021416 | 5021679 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 27 | 2214232 | 2214495 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 28 | 1501848 | 1502099 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 29 | 3334868 | 3335110 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 30 | 247300 | 247533 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 31 | 2625404 | 2625637 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 32 | 2828023 | 2828256 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 33 | 1370870 | 1371139 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 34 | 2723567 | 2723824 | - | NZ_LS483476.1 | Lederbergia lentus |
| 35 | 1151636 | 1151869 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 36 | 3335139 | 3335399 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 37 | 596419 | 596652 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 38 | 1647821 | 1648042 | + | NZ_CP027770.1 | Staphylococcus felis |
| 39 | 1318925 | 1319185 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 40 | 2149523 | 2149789 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 41 | 1745758 | 1745979 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 42 | 1520575 | 1520814 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 43 | 3921991 | 3922236 | - | NC_011725.1 | Bacillus cereus B4264 |
| 44 | 814413 | 814634 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 45 | 2090478 | 2090738 | + | NZ_CP053989.1 | Niallia circulans |
| 46 | 2642025 | 2642288 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 47 | 1616424 | 1616684 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 48 | 1885449 | 1885712 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 49 | 2680185 | 2680451 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 50 | 4163818 | 4164075 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 51 | 1016488 | 1016745 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 52 | 208270 | 208503 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 53 | 614510 | 614794 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 54 | 3458115 | 3458348 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 55 | 2478696 | 2478950 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 56 | 3717904 | 3718167 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 57 | 1211788 | 1212048 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 58 | 3787467 | 3787730 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 59 | 1441630 | 1441875 | + | NZ_CP040336.1 | Bacillus luti |
| 60 | 3928587 | 3928850 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 61 | 982457 | 982702 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 62 | 1736650 | 1736916 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 63 | 929446 | 929739 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 64 | 1841992 | 1842258 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 65 | 962793 | 963071 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 66 | 3707926 | 3708204 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 67 | 2593568 | 2593834 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 68 | 978729 | 978974 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 69 | 2789531 | 2789797 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 70 | 1842436 | 1842660 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 71 | 1493556 | 1493804 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 72 | 2673946 | 2674200 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 73 | 1627888 | 1628160 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 74 | 146427 | 146723 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 75 | 2145455 | 2145682 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 76 | 1237483 | 1237707 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 77 | 1367491 | 1367754 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 78 | 1131331 | 1131621 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 79 | 1419997 | 1420215 | - | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 80 | 3824161 | 3824442 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 81 | 805920 | 806165 | + | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 82 | 70593 | 70820 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 83 | 1658442 | 1658663 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 84 | 1718554 | 1718832 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 85 | 1976648 | 1976902 | + | NZ_CP020028.1 | Paenibacillus kribbensis |
| 86 | 2763870 | 2764088 | - | NZ_CP053187.1 | Turicibacter sanguinis |
| 87 | 340913 | 341167 | - | NZ_CP045298.1 | Paenibacillus brasilensis |
| 88 | 1001338 | 1001574 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 89 | 2978991 | 2979251 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 90 | 1271734 | 1271955 | + | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 91 | 2440609 | 2440854 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 92 | 5446250 | 5446507 | - | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 93 | 217243 | 217506 | + | NZ_CP028251.1 | Leuconostoc mesenteroides |
| 94 | 630172 | 630399 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 95 | 2223667 | 2223921 | - | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 96 | 2752490 | 2752759 | - | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 97 | 2131595 | 2131816 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 98 | 1526538 | 1526765 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 99 | 2431067 | 2431285 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 100 | 4516792 | 4517058 | - | NZ_AP019400.1 | Cohnella abietis |
| 101 | 1617469 | 1617705 | - | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 102 | 2151131 | 2151376 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 103 | 2255467 | 2255712 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 104 | 4209499 | 4209717 | - | NZ_CP013023.1 | Paenibacillus bovis |
| 105 | 2003200 | 2003463 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 106 | 2963194 | 2963457 | + | NZ_CP013661.2 | Planococcus kocurii |
| 107 | 2300239 | 2300502 | - | NZ_CP019401.1 | Planococcus faecalis |
| 108 | 1821697 | 1821960 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 109 | 1138149 | 1138394 | + | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 110 | 887639 | 887908 | + | NZ_CP033433.1 | Cohnella candidum |
| 111 | 2048978 | 2049220 | - | NZ_CP059540.1 | Planococcus maritimus |
| 112 | 695992 | 696282 | - | NZ_CP041217.1 | Saccharibacillus brassicae |
| 113 | 787992 | 788216 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 114 | 2853253 | 2853471 | + | NZ_CP034248.1 | Paenibacillus lentus |
| 115 | 1685961 | 1686251 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 116 | 1403202 | 1403480 | - | NZ_CP046314.1 | Gemella morbillorum |
| 117 | 2171667 | 2171933 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 118 | 137206 | 137454 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 119 | 1105101 | 1105379 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 120 | 1175592 | 1175870 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 121 | 2321893 | 2322186 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 122 | 1658776 | 1659069 | - | NZ_LR134242.1 | Staphylococcus warneri |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT603683.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02578.17 | 0.82 | 100 | 1175.5 | same-strand | Multi-copper polyphenol oxidoreductase laccase |
| 2 | PF01168.22 | 0.97 | 118 | 496.5 | same-strand | Alanine racemase, N-terminal domain |
| 3 | PF04472.14 | 1.0 | 122 | 22.0 | same-strand | Cell division protein SepF |
| 4 | PF17774.3 | 0.96 | 117 | 62 | same-strand | Putative RNA-binding domain in YlmH |
| 5 | PF01479.27 | 0.86 | 105 | 116.0 | same-strand | S4 domain |
| 6 | PF05103.15 | 0.94 | 115 | 934 | same-strand | DivIVA protein |
| 7 | PF00133.24 | 0.94 | 115 | 1816 | same-strand | tRNA synthetases class I (I, L, M and V) |
| 8 | PF08264.15 | 0.94 | 115 | 1816 | same-strand | Anticodon-binding domain of tRNA ligase |
| 9 | PF01252.20 | 0.67 | 82 | 5103.0 | same-strand | Signal peptidase (SPase) II |
| 10 | PF06827.16 | 0.73 | 89 | 1823 | same-strand | Zinc finger found in FPG and IleRS |
++ More..