Result : O31725
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probable sporulation protein YlmC |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1608919 |
| Right | 1609164 |
| Strand | + |
| Nucleotide Sequence | ATGATCAGCATTTCAGAATTTCAGGTAAAGGATGTCGTCAATGTCTCAAACGGAAAAAAGCTGGGGAGTATTGGTGATATTGATATCAATGTGACCACTGGAAAAATTCAGGCGATCATACTCGGAGGAAATGGGAAAGTTCTCGGATTTTTTGGAAAAGAAGAGGAATTGGTCATTCCATGGCGAAATATAGTAAAAATCGGGGAAGATGTAATCTTAGTCCGATTAAGTGAACCACATGCATAA |
| Sequence | MISISEFQVKDVVNVSNGKKLGSIGDIDINVTTGKIQAIILGGNGKVLGFFGKEEELVIPWRNIVKIGEDVILVRLSEPHA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl21591. Profile Description: N/A. The PRC-barrel is an all beta barrel domain found in photosystem reaction centre subunit H of the purple bacteria and RNA metabolism proteins of the RimM group. PRC-barrels are approximately 80 residues long, and found widely represented in bacteria, archaea and plants. This domain is also present at the carboxyl terminus of the pan-bacterial protein RimM, which is involved in ribosomal maturation and processing of 16S rRNA. A family of small proteins conserved in all known euryarchaea are composed entirely of a single stand-alone copy of the domain. |
| Pubmed ID | 9384377 23396918 |
| Domain | CDD:419751 |
| Functional Category | Others |
| Uniprot ID | O31725 |
| ORF Length (Amino Acid) | 81 |
++ More..
| Conservation Analysis |
No. of Species: 76
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1787279 | 1787524 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 2 | 1608919 | 1609164 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 3 | 1581788 | 1582033 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 1575463 | 1575708 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 1613005 | 1613250 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 376986 | 377231 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 1516309 | 1516554 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 2397569 | 2397820 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 1563329 | 1563580 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 1734768 | 1735001 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 1714224 | 1714457 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 12 | 1736877 | 1737110 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 13 | 188421 | 188657 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 14 | 21416 | 21652 | - | NZ_CP043404.1 | Bacillus safensis |
| 15 | 1510788 | 1511024 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 16 | 2442940 | 2443194 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 17 | 1995780 | 1996040 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 18 | 5023793 | 5024062 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 19 | 1693858 | 1694127 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 20 | 1368631 | 1368873 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 21 | 2627749 | 2628006 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 22 | 550670 | 550912 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 23 | 1735407 | 1735649 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 24 | 4048726 | 4048980 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 25 | 2631398 | 2631670 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 26 | 2847272 | 2847514 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 27 | 3460457 | 3460708 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 28 | 2725058 | 2725333 | - | NZ_LS483476.1 | Lederbergia lentus |
| 29 | 982817 | 983059 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 30 | 2216580 | 2216822 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 31 | 593949 | 594191 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 32 | 244940 | 245182 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 33 | 2830374 | 2830616 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 34 | 1599078 | 1599362 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 35 | 1295396 | 1295671 | + | NZ_CP012024.1 | Bacillus smithii |
| 36 | 2644392 | 2644670 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 37 | 1365172 | 1365438 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 38 | 67432 | 67710 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 39 | 2397129 | 2397413 | + | NZ_CP026363.1 | Brevibacillus agri |
| 40 | 2676445 | 2676726 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 41 | 1439230 | 1439508 | + | NZ_CP040336.1 | Bacillus luti |
| 42 | 4161490 | 4161759 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 43 | 593855 | 594133 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 44 | 3720270 | 3720548 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 45 | 3332552 | 3332791 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 46 | 3930954 | 3931232 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 47 | 1018804 | 1019073 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 48 | 1013666 | 1013920 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 49 | 2191995 | 2192273 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 50 | 3924361 | 3924639 | - | NC_011725.1 | Bacillus cereus B4264 |
| 51 | 210611 | 210889 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 52 | 1003645 | 1003902 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 53 | 3789835 | 3790113 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 54 | 4360861 | 4361145 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 55 | 3296600 | 3296884 | + | NZ_CP021434.1 | Tumebacillus avium |
| 56 | 3390889 | 3391158 | - | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 57 | 1300875 | 1301132 | + | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 58 | 760612 | 760875 | + | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 59 | 885272 | 885550 | + | NZ_CP033433.1 | Cohnella candidum |
| 60 | 1542678 | 1542941 | - | NC_013385.1 | Ammonifex degensii KC4 |
| 61 | 1209503 | 1209769 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 62 | 742292 | 742561 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 63 | 3115384 | 3115668 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 64 | 2480988 | 2481260 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 65 | 1883136 | 1883414 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 66 | 2791093 | 2791356 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 67 | 2205726 | 2205974 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 68 | 807385 | 807654 | + | NZ_CP017237.1 | Moorella thermoacetica |
| 69 | 1094560 | 1094838 | + | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 70 | 1882035 | 1882298 | - | NZ_CP036259.1 | Sporomusa termitida |
| 71 | 713333 | 713563 | + | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 72 | 3972130 | 3972396 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 73 | 2178374 | 2178604 | - | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 74 | 1404553 | 1404825 | - | NZ_CP016379.1 | Anoxybacter fermentans |
| 75 | 992220 | 992471 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 76 | 1636544 | 1636822 | + | NZ_AP017312.1 | Aneurinibacillus soli |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP016020.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03419.15 | 0.88 | 67 | 1962 | same-strand | Sporulation factor SpoIIGA |
| 2 | PF04542.16 | 0.93 | 71 | 1045.0 | same-strand | Sigma-70 region 2 |
| 3 | PF04545.18 | 0.93 | 71 | 1045.0 | same-strand | Sigma-70, region 4 |
| 4 | PF02578.17 | 0.87 | 66 | 118.0 | same-strand | Multi-copper polyphenol oxidoreductase laccase |
| 5 | PF01168.22 | 0.87 | 66 | 934.0 | same-strand | Alanine racemase, N-terminal domain |
| 6 | PF04472.14 | 0.86 | 65 | 1630 | same-strand | Cell division protein SepF |
| 7 | PF02325.19 | 0.84 | 64 | 2104.0 | same-strand | YGGT family |
| 8 | PF17774.3 | 0.8 | 61 | 2418 | same-strand | Putative RNA-binding domain in YlmH |
| 9 | PF01479.27 | 0.72 | 55 | 2429 | same-strand | S4 domain |
| 10 | PF00091.27 | 0.7 | 53 | 3328 | same-strand | Tubulin/FtsZ family, GTPase domain |
| 11 | PF12327.10 | 0.7 | 53 | 3328 | same-strand | FtsZ family, C-terminal domain |
++ More..