| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YkzI |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1537113 |
| Right | 1537301 |
| Strand | + |
| Nucleotide Sequence | ATGAGGCAAGTTGTAAAAGAGGGATTTAAGGAAGAGAAAAACAATCGTGTTGCTGTCTGGAGACTAGAGGTTGATTATGAATTGGCAACCCTATATGAAGCAATGCAGAAAGAAAATGAAGAGCAGATTGAACAAAGCAAAAACAAACTTGAGCGACTTAGAAAAGAATGGATTCGTCTTAACGGGTAA |
| Sequence | MRQVVKEGFKEEKNNRVAVWRLEVDYELATLYEAMQKENEEQIEQSKNKLERLRKEWIRLNG |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O31719 |
| ORF Length (Amino Acid) | 62 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1508972 | 1509160 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 2 | 1537113 | 1537301 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 3 | 1503499 | 1503687 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 1714027 | 1714215 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 1442397 | 1442585 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 1540671 | 1540859 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 448262 | 448450 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 1494769 | 1494957 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 2463647 | 2463835 | - | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 1660365 | 1660553 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 1643036 | 1643224 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 12 | 1665644 | 1665832 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 13 | 96633 | 96821 | - | NZ_CP043404.1 | Bacillus safensis |
| 14 | 259816 | 260004 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 15 | 1436935 | 1437123 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 16 | 2516300 | 2516488 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 17 | 1338595 | 1338780 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 18 | 1378786 | 1378983 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 19 | 1677217 | 1677405 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 20 | 1922441 | 1922623 | + | NZ_CP042593.1 | Bacillus dafuensis |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01276.22 | 0.95 | 19 | 1396 | opposite-strand | Orn/Lys/Arg decarboxylase, major domain |
| 2 | PF05256.14 | 0.9 | 18 | 914.0 | same-strand | Uncharacterised protein family (UPF0223) |
| 3 | PF06335.14 | 0.95 | 19 | 240 | opposite-strand | Protein of unknown function (DUF1054) |
| 4 | PF00459.27 | 1.0 | 20 | 138.5 | same-strand | Inositol monophosphatase family |