Result : O31715
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YkoA |
| NCBI Accession ID | AF012285.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 17026 |
| Right | 17295 |
| Strand | - |
| Nucleotide Sequence | TTGAGGCTTTTAACACTTACTGAATATTGCTTACTGATCTTTTTTACGGGCTTTTACCTTGCCGTAACAGGCTTTACCGCCAAAGATATCGGCTTATATATAGGCATAGCCCTTATTTACATATTTTCGCACATTTTTTCTAAACGGCTATTAGAAAAGCGCGGAAAAGAGAACAAACAGGTTCACCTTTTCTTCAGTGTGCTGGCTATTATCGGTTCAGTGTTCATCACGGTTTTATGCATTGCATTGGTCGCTTCTTTTTCAAAATAA |
| Sequence | MRLLTLTEYCLLIFFTGFYLAVTGFTAKDIGLYIGIALIYIFSHIFSKRLLEKRGKENKQVHLFFSVLAIIGSVFITVLCIALVASFSK |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O31715 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1511923 | 1512192 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 473383 | 473652 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 3 | 1477024 | 1477293 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 1515468 | 1515737 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 5 | 1688835 | 1689104 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 1483437 | 1483706 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 7 | 1417235 | 1417504 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 1415157 | 1415426 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 2543198 | 2543467 | + | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 1641391 | 1641660 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 11 | 1617433 | 1617702 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 12 | 1631678 | 1631947 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 13 | 121115 | 121390 | + | NZ_CP043404.1 | Bacillus safensis |
| 14 | 284497 | 284772 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 15 | 1412394 | 1412669 | - | NZ_CP011150.1 | Bacillus altitudinis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12704.9 | 0.8 | 12 | 4625.0 | opposite-strand | MacB-like periplasmic core domain |
| 2 | PF02687.23 | 0.8 | 12 | 4625.0 | opposite-strand | FtsX-like permease family |
| 3 | PF00455.24 | 0.93 | 14 | 3590.0 | opposite-strand | DeoR C terminal sensor domain |
| 4 | PF08220.14 | 0.93 | 14 | 3590.0 | opposite-strand | DeoR-like helix-turn-helix domain |
| 5 | PF08279.14 | 0.6 | 9 | 3590 | opposite-strand | HTH domain |
| 6 | PF00294.26 | 1.0 | 15 | 2682 | opposite-strand | pfkB family carbohydrate kinase |
| 7 | PF00359.24 | 1.0 | 15 | 761 | opposite-strand | Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 |
| 8 | PF02302.19 | 1.0 | 15 | 761 | opposite-strand | PTS system, Lactose/Cellobiose specific IIB subunit |
| 9 | PF10502.11 | 1.0 | 15 | 38 | opposite-strand | Signal peptidase, peptidase S26 |
| 10 | PF00005.29 | 1.0 | 15 | 181 | opposite-strand | ABC transporter |
| 11 | PF12848.9 | 1.0 | 15 | 181 | opposite-strand | ABC transporter |
| 12 | PF02558.18 | 0.6 | 9 | 1864 | opposite-strand | Ketopantoate reductase PanE/ApbA |
| 13 | PF08546.13 | 0.6 | 9 | 1864 | opposite-strand | Ketopantoate reductase PanE/ApbA C terminal |
| 14 | PF02073.17 | 1.0 | 15 | 2801 | same-strand | Thermophilic metalloprotease (M29) |
| 15 | PF17447.4 | 1.0 | 15 | 4144 | same-strand | Uncharacterized YkpC-like |
| 16 | PF06723.15 | 0.8 | 12 | 4377.5 | same-strand | MreB/Mbl protein |
| 17 | PF14450.8 | 0.8 | 12 | 4377.5 | same-strand | Cell division protein FtsA |
++ More..