| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YkzF |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1485118 |
| Right | 1485315 |
| Strand | + |
| Nucleotide Sequence | TTGCGAATGAGTCTTATCGGTGAACGATTTACAGAAGAAGAACAAAAACTTCTGCTGAATATCCTGATCAACCATGAGTATGCCATCGAGCTATTAAGCAGTGAGATCAACGATATAGAGACAGGGACCAAAAACGTTGACGGAACCACCTACAAAAAACTTGTAACGCTATACGACCGATTTCGATTTGAAAATTAA |
| Sequence | MRMSLIGERFTEEEQKLLLNILINHEYAIELLSSEINDIETGTKNVDGTTYKKLVTLYDRFRFEN |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam14156. Profile Description: Antirepressor AbbA. This family inactivates the repressor AbrB, which represses genes switched on during the transition from the exponential to the stationary phase of growth. It binds to AbrB and prevents it from binding to DNA. |
| Pubmed ID | 9384377 |
| Domain | CDD:404944 |
| Functional Category | Others |
| Uniprot ID | O31697 |
| ORF Length (Amino Acid) | 65 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1662014 | 1662211 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 2 | 1488626 | 1488817 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 3 | 1448914 | 1449111 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 1456620 | 1456817 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 500302 | 500493 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 1485118 | 1485315 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 7 | 1390434 | 1390631 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 2565942 | 2566133 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 1392483 | 1392674 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 1604201 | 1604380 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 1590276 | 1590455 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 12 | 1613675 | 1613854 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 13 | 1387811 | 1388002 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 14 | 309184 | 309375 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 15 | 144968 | 145159 | - | NZ_CP043404.1 | Bacillus safensis |
| 16 | 2482080 | 2482271 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 17 | 463020 | 463217 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 18 | 1655074 | 1655247 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 19 | 2924273 | 2924434 | - | NZ_CP070511.1 | Parageobacillus toebii |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13561.8 | 0.68 | 13 | 3005 | same-strand | Enoyl-(Acyl carrier protein) reductase |
| 2 | PF00106.27 | 0.68 | 13 | 3005 | same-strand | short chain dehydrogenase |
| 3 | PF10388.11 | 0.95 | 18 | 1690.0 | same-strand | EAL-domain associated signalling protein domain |
| 4 | PF00563.22 | 0.95 | 18 | 1690.0 | same-strand | EAL domain |
| 5 | PF08796.12 | 0.79 | 15 | 782 | same-strand | Protein of unknown function (DUF1797) |
| 6 | PF04308.14 | 0.74 | 14 | 139.0 | same-strand | Ribonuclease H-like |
| 7 | PF03466.22 | 0.89 | 17 | 729 | same-strand | LysR substrate binding domain |
| 8 | PF00126.29 | 0.89 | 17 | 729 | same-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
| 9 | PF00258.27 | 0.79 | 15 | 2273.5 | same-strand | Flavodoxin |