Result : O31684
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YkvS |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1447662 |
| Right | 1447847 |
| Strand | - |
| Nucleotide Sequence | GTGAAAATCGCTAAGGTTGGGAATGTCATTGAATTTAAAAACGGATTAACCGGTGTTGTTGAAAAAGTAAATGAGAATTCTGTTATCGTTGATGTGACGATCATGGATAACTATCGGGATCTTGAGTTAGATTCATTGACAGTTGTTAATCATAAAAATTATAAGATCATCAGAGACTCCTATTAA |
| Sequence | MKIAKVGNVIEFKNGLTGVVEKVNENSVIVDVTIMDNYRDLELDSLTVVNHKNYKIIRDSY |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23969. Profile Description: Uncharacterized protein conserved in bacteria (DUF2187). This domain, found in various hypothetical bacterial proteins, has no known function. |
| Pubmed ID | 9384377 |
| Domain | CDD:420124 |
| Functional Category | Others |
| Uniprot ID | O31684 |
| ORF Length (Amino Acid) | 61 |
++ More..
| Conservation Analysis |
No. of Species: 92
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1358853 | 1359038 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 2 | 2599585 | 2599770 | + | NZ_CP011937.1 | Bacillus velezensis |
| 3 | 1447662 | 1447847 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 4 | 1356512 | 1356697 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 1414794 | 1414979 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 6 | 1627959 | 1628153 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 7 | 1420417 | 1420602 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 8 | 538542 | 538727 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 9 | 1453890 | 1454075 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 10 | 1559763 | 1559951 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 351769 | 351957 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 12 | 1346606 | 1346794 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 13 | 197609 | 197797 | + | NZ_CP043404.1 | Bacillus safensis |
| 14 | 1551403 | 1551591 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 15 | 1574804 | 1574992 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 16 | 2687888 | 2688076 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 17 | 1556563 | 1556751 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 18 | 2742640 | 2742831 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 19 | 5142133 | 5142321 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 20 | 4044436 | 4044612 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 21 | 128483 | 128659 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 22 | 1264694 | 1264879 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 23 | 2342577 | 2342753 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 24 | 1616460 | 1616636 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 25 | 2966932 | 2967108 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 26 | 2965424 | 2965600 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 27 | 1435857 | 1436036 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 28 | 1870258 | 1870446 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 29 | 1883007 | 1883186 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 30 | 2823845 | 2824036 | + | NZ_LS483476.1 | Lederbergia lentus |
| 31 | 318997 | 319179 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 32 | 1231404 | 1231580 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 33 | 3350621 | 3350809 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 34 | 476549 | 476728 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 35 | 843340 | 843516 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 36 | 2432694 | 2432873 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 37 | 1995952 | 1996125 | - | NZ_CP053989.1 | Niallia circulans |
| 38 | 1877620 | 1877820 | + | NZ_LR134483.1 | Listeria grayi |
| 39 | 819494 | 819682 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 40 | 3850455 | 3850643 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 41 | 407053 | 407229 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 42 | 2518594 | 2518788 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 43 | 1720729 | 1720914 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 44 | 445823 | 446008 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 45 | 1530861 | 1531040 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 46 | 1175559 | 1175744 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 47 | 3783173 | 3783358 | + | NZ_CP040336.1 | Bacillus luti |
| 48 | 1292400 | 1292585 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 49 | 1319259 | 1319444 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 50 | 1178636 | 1178815 | - | NZ_CP012024.1 | Bacillus smithii |
| 51 | 932304 | 932486 | + | NZ_CP065729.1 | Macrococcus caseolyticus |
| 52 | 3975495 | 3975683 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 53 | 948329 | 948541 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 54 | 1353232 | 1353417 | - | NC_011725.1 | Bacillus cereus B4264 |
| 55 | 1798390 | 1798575 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 56 | 800326 | 800508 | - | NZ_CP047361.1 | Macrococcus canis |
| 57 | 1301465 | 1301650 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 58 | 1197370 | 1197558 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 59 | 2501888 | 2502073 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 60 | 952142 | 952318 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 61 | 1011515 | 1011691 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 62 | 941193 | 941369 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 63 | 1861475 | 1861660 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 64 | 748549 | 748734 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 65 | 656247 | 656432 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 66 | 321519 | 321695 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 67 | 1510686 | 1510871 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 68 | 284305 | 284490 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 69 | 1980807 | 1980992 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 70 | 1820494 | 1820679 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 71 | 698054 | 698230 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 72 | 1658562 | 1658747 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 73 | 823205 | 823390 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 74 | 1788581 | 1788766 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 75 | 2192291 | 2192476 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 76 | 2040111 | 2040296 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 77 | 879668 | 879847 | - | NZ_CP054482.1 | Macrococcus bohemicus |
| 78 | 766114 | 766299 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 79 | 1977778 | 1977963 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 80 | 1819126 | 1819311 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 81 | 1911540 | 1911725 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 82 | 1126025 | 1126210 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 83 | 618293 | 618478 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 84 | 1896010 | 1896195 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 85 | 1067529 | 1067714 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 86 | 1467028 | 1467213 | - | NZ_CP027770.1 | Staphylococcus felis |
| 87 | 1003656 | 1003814 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 88 | 2896550 | 2896741 | - | NZ_CP015108.1 | Sporosarcina ureae |
| 89 | 718173 | 718376 | - | NZ_CP011366.1 | Salinicoccus halodurans |
| 90 | 456998 | 457207 | - | NZ_CP019573.1 | Abyssicoccus albus |
| 91 | 686434 | 686613 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 92 | 475432 | 475611 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
++ More..