Result : O31683
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YkvR |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1447251 |
| Right | 1447541 |
| Strand | + |
| Nucleotide Sequence | GTGAAGACATTGCGGTTAAACAATGTAACGTTAGAAATGGCTGCATATCAAGAGGAGAGCGAGCCGAAGCGAAAAATTGCATTTACCTTAAACGTTACGAGTGAGACTTACCATGATATCGCTGTCCTGTTGTATGAAAAAACGTTTAATGTCGAGGTTCCGGAACGCGATCTTGCCTTCCGGGGGGAAATGACAAATTATTCAACATCATTGACCAACCTGTACGAACCAGGGGCCGTCAGCGAGTTCTATATAGAAATAACGGAAATAGACAAAAACGCCGATTCATGA |
| Sequence | MKTLRLNNVTLEMAAYQEESEPKRKIAFTLNVTSETYHDIAVLLYEKTFNVEVPERDLAFRGEMTNYSTSLTNLYEPGAVSEFYIEITEIDKNADS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam11514. Profile Description: Protein of unknown function (DUF3219). This family of proteins with unknown function appears to be restricted to Bacillaceae. Some members in this family of proteins are annotated as YkvR however this cannot be confirmed. |
| Pubmed ID | 9384377 |
| Domain | CDD:402902 |
| Functional Category | Others |
| Uniprot ID | O31683 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1447251 | 1447541 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1356102 | 1356392 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 1414383 | 1414673 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 538848 | 539138 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 5 | 1453478 | 1453768 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 1420003 | 1420293 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 7 | 1627555 | 1627845 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 8 | 2599844 | 2600119 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 1358505 | 1358780 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP048852.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09953.11 | 1.0 | 9 | 121 | opposite-strand | Uncharacterized protein conserved in bacteria (DUF2187) |
| 2 | PF07486.14 | 1.0 | 9 | 963 | same-strand | Cell Wall Hydrolase |
| 3 | PF01943.19 | 1.0 | 9 | 1709 | same-strand | Polysaccharide biosynthesis protein |
| 4 | PF01554.20 | 1.0 | 9 | 1709 | same-strand | MatE |
| 5 | PF00578.23 | 1.0 | 9 | 3097 | same-strand | AhpC/TSA family |
| 6 | PF13905.8 | 1.0 | 9 | 3097 | same-strand | Thioredoxin-like |
| 7 | PF13098.8 | 1.0 | 9 | 3097 | same-strand | Thioredoxin-like domain |
| 8 | PF14489.8 | 0.78 | 7 | 2225 | same-strand | QueF-like protein |
++ More..