Result : O31659
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YkzE |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1417719 |
| Right | 1417895 |
| Strand | + |
| Nucleotide Sequence | GTGAAGAAAAACCGTCATAGCAGAGACATGCAAAATCATAAAAAGCCTATGAATAAAAAGGTGCTGGAGGAAGAATTCTCAAGTGAACTCGGGGATTACAATGCCGGAAAGATCATCGAAACGCTGGAAGTCACCAAGCCTGAAAAGAAAAAAGAAAAAAACAAAAAACAACAATAA |
| Sequence | MKKNRHSRDMQNHKKPMNKKVLEEEFSSELGDYNAGKIIETLEVTKPEKKKEKNKKQQ |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O31659 |
| ORF Length (Amino Acid) | 58 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1417719 | 1417895 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1329804 | 1329974 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 2626831 | 2627001 | - | NZ_CP011937.1 | Bacillus velezensis |
| 4 | 375135 | 375287 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 5 | 1322506 | 1322658 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 6 | 223198 | 223341 | - | NZ_CP043404.1 | Bacillus safensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP017786.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08876.13 | 1.0 | 6 | 3401.0 | opposite-strand | Domain of unknown function (DUF1836) |
| 2 | PF01435.20 | 1.0 | 6 | 2291.0 | same-strand | Peptidase family M48 |
| 3 | PF02386.18 | 1.0 | 6 | 790.5 | same-strand | Cation transport protein |
| 4 | PF01757.24 | 1.0 | 6 | 41.0 | opposite-strand | Acyltransferase family |
| 5 | PF02518.28 | 1.0 | 6 | 1330.5 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 6 | PF08448.12 | 1.0 | 6 | 1330.5 | same-strand | PAS fold |
| 7 | PF13426.9 | 0.83 | 5 | 1342 | same-strand | PAS domain |
| 8 | PF00512.27 | 1.0 | 6 | 1330.5 | same-strand | His Kinase A (phospho-acceptor) domain |
| 9 | PF01035.22 | 1.0 | 6 | 3540.0 | same-strand | 6-O-methylguanine DNA methyltransferase, DNA binding domain |
| 10 | PF02870.17 | 1.0 | 6 | 3540.0 | same-strand | 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain |
| 11 | PF01008.19 | 1.0 | 6 | 4280.5 | opposite-strand | Initiation factor 2 subunit family |
| 12 | PF00989.27 | 0.83 | 5 | 1342 | same-strand | PAS fold |
| 13 | PF14501.8 | 0.67 | 4 | 1345.0 | same-strand | GHKL domain |
++ More..