Result : O31653
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YkzH |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1374068 |
| Right | 1374292 |
| Strand | - |
| Nucleotide Sequence | ATGAAAAATCAGAAGTCGAATACCCTTTGGCCCTTTGATCTGCCATTGGCTCCCCAACCCGAGGGCTACCAGCAGCAAACAATCGACAGGCTGGCCGGTTTGGAGCTAAGAATGAAGCAACTAATTAGAGCGATTGAGGTAAACAATGAATTGCTGAGAACAATGCAAGAACAGCAAAACCGTGTATGCACAAATGGCAGCGGGTCTGTGATTGTCCGGATGTAG |
| Sequence | MKNQKSNTLWPFDLPLAPQPEGYQQQTIDRLAGLELRMKQLIRAIEVNNELLRTMQEQQNRVCTNGSGSVIVRM |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O31653 |
| ORF Length (Amino Acid) | 74 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1374068 | 1374292 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1347553 | 1347783 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 1343926 | 1344156 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 611614 | 611838 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 5 | 1382836 | 1383060 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 2085427 | 2085651 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 7 | 2139108 | 2139332 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 0.71 | 5 | 4270 | opposite-strand | ABC transporter |
| 2 | PF08352.14 | 0.71 | 5 | 4270 | opposite-strand | Oligopeptide/dipeptide transporter, C-terminal region |
| 3 | PF02463.21 | 0.71 | 5 | 4270 | opposite-strand | RecF/RecN/SMC N terminal domain |
| 4 | PF10282.11 | 0.71 | 5 | 3182 | same-strand | Lactonase, 7-bladed beta-propeller |
| 5 | PF19420.1 | 0.71 | 5 | 2200 | same-strand | N,N dimethylarginine dimethylhydrolase, eukaryotic |
| 6 | PF03061.24 | 0.71 | 5 | 1525 | opposite-strand | Thioesterase superfamily |
| 7 | PF00175.23 | 0.71 | 5 | 77 | opposite-strand | Oxidoreductase NAD-binding domain |
| 8 | PF00042.24 | 0.71 | 5 | 77 | opposite-strand | Globin |
| 9 | PF00970.26 | 0.71 | 5 | 77 | opposite-strand | Oxidoreductase FAD-binding domain |
| 10 | PF04239.14 | 0.71 | 5 | 154 | opposite-strand | Protein of unknown function (DUF421) |
| 11 | PF12867.9 | 0.71 | 5 | 978 | opposite-strand | DinB superfamily |
| 12 | PF04978.14 | 0.71 | 5 | 978 | opposite-strand | Protein of unknown function (DUF664) |
| 13 | PF13302.9 | 0.71 | 5 | 1495 | opposite-strand | Acetyltransferase (GNAT) domain |
| 14 | PF00893.21 | 0.71 | 5 | 2412.0 | opposite-strand | Small Multidrug Resistance protein |
++ More..