Result : O31639
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YjcQ |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1267129 |
| Right | 1267413 |
| Strand | + |
| Nucleotide Sequence | ATGAATAAGGATAAATTAAGGTATGCAATCTTAAAAGAAATTTTTGAAGGTAATACCCCTTTGTCAGAAAACGATATTGGAGTTACTGAAGATCAATTTGATGATGCTGTGAACTTTTTAAAACGCGAAGGGTATATCATTGGGGTCCATTATTCAGATGATAGACCTCATTTATACAAATTAGGACCTGAACTGACAGAGAAAGGTGAAAACTACTTGAAAGAGAATGGAACATGGTCTAAGGCCTATAAGACCATTAAAGAGATTAAAGATTGGATTAAATAA |
| Sequence | MNKDKLRYAILKEIFEGNTPLSENDIGVTEDQFDDAVNFLKREGYIIGVHYSDDRPHLYKLGPELTEKGENYLKENGTWSKAYKTIKEIKDWIK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam09639. Profile Description: YjcQ protein. YjcQ is a protein of approx. 100 residues containing four alpha helices and three beta strands. It is expressed in bacteria and also in viruses. It appears to be under the regulation of SigD RNA polymerase which is responsible for the expression of many genes encoding cell-surface proteins related to flagellar assembly, motility, chemotaxis and autolysis in the late exponential growth phase. The exact function of YjcQ is unknown. However, it is thought to be a prophage head protein in viruses. |
| Pubmed ID | 9384377 15033535 |
| Domain | CDD:401540 |
| Functional Category | Others |
| Uniprot ID | O31639 |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1267129 | 1267413 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1395161 | 1395445 | + | NZ_CP011937.1 | Bacillus velezensis |
| 3 | 2395493 | 2395750 | + | NZ_AP019400.1 | Cohnella abietis |
| 4 | 1066867 | 1067154 | + | NZ_CP019699.1 | Novibacillus thermophilus |
++ More..