| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YhzC |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1116583 |
| Right | 1116816 |
| Strand | - |
| Nucleotide Sequence | ATGAAAGAGAAAAAATCGTACACTGAGCTCATGAAGTCCCGCAACACGCAAAAAACAAAAGAATTCGATGTCACAATGACGGATATTTACATTCAAATGGTGCTCGATGAATCCTTGTATAACCGTCGGCTTGCCATGCTGACGGACCAAATTAACAAAGCCTTGGACGAAAAAGATAAAGATGCGTTTCTTACGCTCTCTAAAGAATATGCAGCGCTCAAGCAGAGCGAATAA |
| Sequence | MKEKKSYTELMKSRNTQKTKEFDVTMTDIYIQMVLDESLYNRRLAMLTDQINKALDEKDKDAFLTLSKEYAALKQSE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl26684. Profile Description: IDEAL domain. It is found at the C-terminus of proteins in the UPF0302 family. It is named after the sequence of the most conserved region in some members. |
| Pubmed ID | 9384377 |
| Domain | CDD:421379 |
| Functional Category | Others |
| Uniprot ID | O31594 |
| ORF Length (Amino Acid) | 77 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1116583 | 1116816 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1101184 | 1101417 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 1294056 | 1294289 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 1120516 | 1120749 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 5 | 1048883 | 1049116 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 1089392 | 1089625 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 7 | 875691 | 875924 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 1039800 | 1040033 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 2906823 | 2907056 | + | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 1119620 | 1119853 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 1213227 | 1213460 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 1193796 | 1194029 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 13 | 610815 | 611051 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 14 | 1018184 | 1018420 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 15 | 476248 | 476484 | + | NZ_CP043404.1 | Bacillus safensis |
| 16 | 2002739 | 2002960 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 17 | 3214954 | 3215190 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF11563.10 | 0.88 | 15 | 2665 | same-strand | Protoglobin |
| 2 | PF00015.23 | 0.88 | 15 | 2665 | same-strand | Methyl-accepting chemotaxis protein (MCP) signalling domain |
| 3 | PF01266.26 | 0.88 | 15 | 1013 | same-strand | FAD dependent oxidoreductase |
| 4 | PF00355.28 | 0.82 | 14 | 1005.5 | same-strand | Rieske [2Fe-2S] domain |
| 5 | PF13561.8 | 0.88 | 15 | 58.0 | opposite-strand | Enoyl-(Acyl carrier protein) reductase |
| 6 | PF00106.27 | 0.88 | 15 | 58.0 | opposite-strand | short chain dehydrogenase |
| 7 | PF08659.12 | 0.88 | 15 | 58.0 | opposite-strand | KR domain |
| 8 | PF06338.13 | 1.0 | 17 | 293 | opposite-strand | ComK protein |