Result : O31586
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YgzA |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 954291 |
| Right | 954494 |
| Strand | + |
| Nucleotide Sequence | ATGGAAGTGAATAAAGAAAGTTTGGTTGCAGATGAATTACACAGAATGTTTTTGGCTGGTGAGCTGCAAATCACAGTAGAGGAGGATATAAACAATATTTCCGAAAGGCTGAGAAACGGCGATCTCAGTTTAGACCGATTAAGCGGTGAAGACGTGTTTATAAAAGAAACGGTAAATGAGGCTTTAAGAAGAGTGGAGCAATAA |
| Sequence | MEVNKESLVADELHRMFLAGELQITVEEDINNISERLRNGDLSLDRLSGEDVFIKETVNEALRRVEQ |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 19383706 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O31586 |
| ORF Length (Amino Acid) | 67 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 954291 | 954494 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 934733 | 934915 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 925113 | 925295 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 1136027 | 1136224 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 888553 | 888735 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 953491 | 953688 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 1043955 | 1044152 | - | NZ_CP029364.1 | Bacillus halotolerans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP034943.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01475.21 | 0.71 | 5 | 9378 | same-strand | Ferric uptake regulator family |
| 2 | PF11023.10 | 0.71 | 5 | 8990 | opposite-strand | Zinc-ribbon containing domain |
| 3 | PF14540.8 | 0.71 | 5 | 7897 | same-strand | Nucleotidyltransferase-like |
| 4 | PF18576.3 | 0.71 | 5 | 7897 | same-strand | Helix-turn-helix domain |
| 5 | PF07070.13 | 1.0 | 7 | 153 | opposite-strand | SpoOM protein |
| 6 | PF03575.19 | 1.0 | 7 | 432 | same-strand | Peptidase family S51 |
| 7 | PF01964.20 | 1.0 | 7 | 1432 | same-strand | Radical SAM ThiC family |
| 8 | PF13667.8 | 1.0 | 7 | 1432 | same-strand | ThiC-associated domain |
| 9 | PF00199.21 | 0.71 | 5 | 3561 | opposite-strand | Catalase |
| 10 | PF06628.14 | 0.71 | 5 | 3561 | opposite-strand | Catalase-related immune-responsive |
| 11 | PF07875.14 | 0.71 | 5 | 65 | opposite-strand | Coat F domain |
++ More..