Result : O31585
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YfhS |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 936773 |
| Right | 936997 |
| Strand | - |
| Nucleotide Sequence | ATGTATGTCGGACGTGATATGAGCGAATTGAACATGGTTTCCAAAAAAGATTGGAAGAACAGTGAACTCGCTTATTTTCATCATGCCTTTCAGCAAATTATGCCTTATTTGAACGAAGAAGGCCAATCAAAATACCGGGAATTAACGCAAGAAATTGAAGCGCGCGGCGGAATGAAGCGCAATGAAGCGGACTACAGCCACGGCACGCGCGTCTCTTACGATTAA |
| Sequence | MYVGRDMSELNMVSKKDWKNSELAYFHHAFQQIMPYLNEEGQSKYRELTQEIEARGGMKRNEADYSHGTRVSYD |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 10463184 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O31585 |
| ORF Length (Amino Acid) | 74 |
++ More..
| Conservation Analysis |
No. of Species: 45
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 936773 | 936997 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 907573 | 907797 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 918514 | 918738 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 927780 | 928004 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 5 | 1118362 | 1118586 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 1061471 | 1061695 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 871033 | 871257 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 3083970 | 3084194 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 861101 | 861325 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 779805 | 780029 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 11 | 645127 | 645351 | + | NZ_CP043404.1 | Bacillus safensis |
| 12 | 848850 | 849074 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 13 | 3521029 | 3521253 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 14 | 491733 | 491957 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 15 | 487079 | 487303 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 16 | 393799 | 394023 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 17 | 500769 | 500993 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 18 | 516115 | 516339 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 19 | 1857832 | 1858056 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 20 | 509926 | 510150 | - | NC_011725.1 | Bacillus cereus B4264 |
| 21 | 3180669 | 3180893 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 22 | 512213 | 512437 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 23 | 1028403 | 1028627 | - | NZ_CP053989.1 | Niallia circulans |
| 24 | 989235 | 989459 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 25 | 588624 | 588848 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 26 | 953010 | 953234 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 27 | 355703 | 355927 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 28 | 905409 | 905633 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 29 | 2102219 | 2102443 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 30 | 1005745 | 1005969 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 31 | 3650854 | 3651078 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 32 | 854288 | 854512 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 33 | 32609 | 32833 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 34 | 675032 | 675256 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 35 | 1214519 | 1214743 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 36 | 604253 | 604474 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 37 | 505736 | 505960 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 38 | 3209044 | 3209268 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 39 | 3438151 | 3438375 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 40 | 1759296 | 1759520 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 41 | 2729568 | 2729792 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 42 | 722961 | 723164 | - | NZ_CP012024.1 | Bacillus smithii |
| 43 | 3218733 | 3218957 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 44 | 1004659 | 1004880 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 45 | 1064905 | 1065129 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04307.16 | 0.76 | 34 | 1336.0 | same-strand | LexA-binding, inner membrane-associated putative hydrolase |
| 2 | PF14815.8 | 0.96 | 43 | 14 | opposite-strand | NUDIX domain |
| 3 | PF00730.27 | 0.96 | 43 | 14 | opposite-strand | HhH-GPD superfamily base excision DNA repair protein |
| 4 | PF00633.25 | 0.91 | 41 | 14 | opposite-strand | Helix-hairpin-helix motif |
| 5 | PF13561.8 | 0.8 | 36 | 82.0 | opposite-strand | Enoyl-(Acyl carrier protein) reductase |
| 6 | PF00106.27 | 0.8 | 36 | 82.0 | opposite-strand | short chain dehydrogenase |
| 7 | PF14182.8 | 0.73 | 33 | 1279 | opposite-strand | YgaB-like protein |
| 8 | PF04167.15 | 1.0 | 45 | 1642 | opposite-strand | Protein of unknown function (DUF402) |
| 9 | PF00664.25 | 0.8 | 36 | 2268.0 | opposite-strand | ABC transporter transmembrane region |
| 10 | PF00005.29 | 0.89 | 40 | 2268 | opposite-strand | ABC transporter |
++ More..