Result : O31578
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YfhJ |
| NCBI Accession ID | D85082.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 17967 |
| Right | 18236 |
| Strand | + |
| Nucleotide Sequence | ATGAATATGTACATTGAGAAACTGACTAATCTGCTTCTGGAAAAGAACGAGATGATCAGCTATATACAGGCAAAAACGTGGGTGGAATTGTTATGGAGCGATTTCGAAGCAACCTACGCAAAAGCCGGACACGCCTATCAAGGTGAAAAAATGACTGAAAAAATCGTCACACAATGGATTGAAAACTATGGCGGCCAGCTCCACCTTTTTCAAAGCTCCCGTAACGACGTGAATGATTACTTAAATCAAAGCAGAGGCCTTTTGCATTAA |
| Sequence | MNMYIEKLTNLLLEKNEMISYIQAKTWVELLWSDFEATYAKAGHAYQGEKMTEKIVTQWIENYGGQLHLFQSSRNDVNDYLNQSRGLLH |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam14043. Profile Description: WVELL protein. This family includes the B. subtilis YfjH protein, which is functionally uncharacterized. This is not a homolog of E. coli YfjH, a synonym for IscX, which belongs to pfam04384. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length and contain a highly conserved WVELL motif. |
| Pubmed ID | 8946165 9384377 |
| Domain | CDD:379438 |
| Functional Category | Others |
| Uniprot ID | O31578 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 34
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 928389 | 928658 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 899195 | 899464 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 910130 | 910399 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 1109999 | 1110268 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 918833 | 919102 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 1070502 | 1070771 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 862642 | 862911 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 3092251 | 3092520 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 852779 | 853048 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 898276 | 898494 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 982062 | 982280 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 663789 | 664061 | - | NZ_CP043404.1 | Bacillus safensis |
| 13 | 791140 | 791412 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 14 | 837231 | 837503 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 15 | 945227 | 945445 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 16 | 1199838 | 1200107 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 17 | 851503 | 851772 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 18 | 3641167 | 3641436 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 19 | 41722 | 41991 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 20 | 1860817 | 1861083 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 21 | 3177548 | 3177814 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 22 | 1025612 | 1025845 | + | NZ_CP053989.1 | Niallia circulans |
| 23 | 488385 | 488651 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 24 | 1002672 | 1002911 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 25 | 3315910 | 3316176 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 26 | 513562 | 513828 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 27 | 585703 | 585963 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 28 | 824592 | 824861 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 29 | 687524 | 687772 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 30 | 711480 | 711743 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 31 | 934503 | 934754 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 32 | 965124 | 965375 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 33 | 4000289 | 4000558 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 34 | 734391 | 734660 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_006270.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02631.18 | 1.0 | 34 | 1320.5 | same-strand | RecX family |
| 2 | PF08838.12 | 1.0 | 34 | 540.0 | same-strand | Protein of unknown function (DUF1811) |
| 3 | PF08176.14 | 0.68 | 23 | 125 | opposite-strand | Small acid-soluble spore protein K family |
| 4 | PF04307.16 | 0.65 | 22 | 57.0 | opposite-strand | LexA-binding, inner membrane-associated putative hydrolase |
++ More..