Result : O31573
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YfhE |
| NCBI Accession ID | D85082.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 14046 |
| Right | 14156 |
| Strand | - |
| Nucleotide Sequence | ATGGAAAAAAAGAGGGAGAAGCACCAGCAAGGCGCCAACCTGAAAAAAATGCAGGAAGTTCTTTATTCAGGCGAATTTAAAAAAGCGGAAAAAGCTGCTAAGCGGAAGTAG |
| Sequence | MEKKREKHQQGANLKKMQEVLYSGEFKKAEKAAKRK |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 8946165 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O31573 |
| ORF Length (Amino Acid) | 36 |
++ More..
| Conservation Analysis |
No. of Species: 18
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1106075 | 1106185 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 2 | 924468 | 924578 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 3 | 906083 | 906193 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 895268 | 895378 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 858716 | 858826 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 847447 | 847557 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 7 | 3097744 | 3097854 | + | NZ_CP011937.1 | Bacillus velezensis |
| 8 | 1074583 | 1074693 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 9 | 914908 | 915018 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 10 | 666703 | 666813 | + | NZ_CP043404.1 | Bacillus safensis |
| 11 | 834439 | 834549 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 12 | 794254 | 794364 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 13 | 894661 | 894774 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 14 | 493091 | 493210 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 15 | 4617734 | 4617853 | + | NZ_CP040336.1 | Bacillus luti |
| 16 | 504530 | 504649 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 17 | 484111 | 484230 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 18 | 502412 | 502531 | - | NC_011725.1 | Bacillus cereus B4264 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP033052.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00881.26 | 0.72 | 13 | 297 | opposite-strand | Nitroreductase family |
| 2 | PF14151.8 | 0.72 | 13 | 67 | same-strand | YfhD-like protein |
| 3 | PF01370.23 | 1.0 | 18 | 58 | same-strand | NAD dependent epimerase/dehydratase family |
| 4 | PF08338.13 | 0.94 | 17 | 55 | same-strand | Domain of unknown function (DUF1731) |
| 5 | PF02631.18 | 1.0 | 18 | 1055.0 | opposite-strand | RecX family |
| 6 | PF08838.12 | 1.0 | 18 | 1854.0 | opposite-strand | Protein of unknown function (DUF1811) |
++ More..