Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YfhD |
NCBI Accession ID | D85082.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 13788 |
Right | 13979 |
Strand | - |
Nucleotide Sequence | ATGGGCAGAAATCATATCCACAAAAACCGTGATAAAAACAAACAAAAGCTTCCACAAGTTCCCGATGCCTTAAAAAGGGAAACTGACGGCGTTTACGAAGAATATTCAACCGAGCTTGCTGATGCAGATGACCGCGAAGCGCAAGAGCGTGCGAAAGCAGCCGACAACAGAGCGAAAAAGAAATCTCGTTAA |
Sequence | MGRNHIHKNRDKNKQKLPQVPDALKRETDGVYEEYSTELADADDREAQERAKAADNRAKKKSR |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam14151. Profile Description: YfhD-like protein. The YfhD-like protein family includes the B. subtilis YfhD protein, which is functionally uncharacterized. Its expression is regulated by the sporulation-specific sigma factor sigma-F. This family of proteins is found in bacteria. Proteins in this family are approximately 50 amino acids in length. There is a single completely conserved residue E that may be functionally important. |
Pubmed ID | 8946165 9384377 |
Domain | CDD:372930 |
Functional Category | Others |
Uniprot ID | O31572 |
ORF Length (Amino Acid) | 63 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 924210 | 924401 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 1105817 | 1106008 | - | NZ_CP033052.1 | Bacillus vallismortis |
3 | 905825 | 906016 | - | NZ_CP013984.1 | Bacillus inaquosorum |
4 | 858458 | 858649 | - | NZ_CP048852.1 | Bacillus tequilensis |
5 | 895010 | 895201 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
6 | 3097925 | 3098116 | + | NZ_CP011937.1 | Bacillus velezensis |
7 | 847185 | 847376 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
8 | 914651 | 914842 | - | NZ_CP051464.1 | Bacillus mojavensis |
9 | 1074759 | 1074950 | + | NZ_CP029364.1 | Bacillus halotolerans |
10 | 894398 | 894592 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
11 | 942145 | 942339 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
12 | 978185 | 978379 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
13 | 3113705 | 3113884 | + | NZ_LS483476.1 | Lederbergia lentus |
14 | 3227275 | 3227460 | + | NZ_CP065425.1 | Heyndrickxia vini |
15 | 717413 | 717604 | - | NZ_CP012024.1 | Bacillus smithii |
16 | 1424684 | 1424866 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
17 | 998643 | 998825 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
18 | 3314618 | 3314800 | - | NZ_CP017703.1 | Aeribacillus pallidus |
19 | 3174547 | 3174723 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
20 | 3530652 | 3530846 | + | NZ_CP016020.1 | Bacillus weihaiensis |
21 | 1111679 | 1111870 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
22 | 46534 | 46722 | + | NZ_CP070511.1 | Parageobacillus toebii |
23 | 2108156 | 2108332 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
24 | 1511658 | 1511843 | + | NZ_CP020772.1 | Halobacillus mangrovi |
25 | 2910693 | 2910881 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
26 | 829014 | 829205 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
27 | 1195132 | 1195320 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
28 | 2467956 | 2468129 | - | NZ_CP041666.1 | Radiobacillus deserti |
29 | 845095 | 845274 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF14152.8 | 0.83 | 24 | 76.5 | same-strand | YfhE-like protein |
2 | PF08338.13 | 0.66 | 19 | 289 | same-strand | Domain of unknown function (DUF1731) |
3 | PF02631.18 | 0.83 | 24 | 1232.0 | opposite-strand | RecX family |
4 | PF08838.12 | 0.69 | 20 | 2028.5 | opposite-strand | Protein of unknown function (DUF1811) |