| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YezD |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 787715 |
| Right | 787882 |
| Strand | + |
| Nucleotide Sequence | TTGGTTTCTAAATCAACGATTGATCCGGAAGTGATTGAAAAAATCATCAGCTCGCTGGAAACACTCGATTTCGGCACGGTTCAGATTACGGTTCATGATTCTCAGATTACCCAAATTGAGAAAATAGAAAAGCACCGTTTTTCGCTGAAAAGGAAAGAATCAAAATGA |
| Sequence | MVSKSTIDPEVIEKIISSLETLDFGTVQITVHDSQITQIEKIEKHRFSLKRKESK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl02371. Profile Description: Uncharacterized small protein (DUF2292). OscA (organosulfur compound A) is a small protein, about 60 amino acids in length, in the DUF2292 family. As characterized in Pseudomonas corrugata, OscA is required during sulfur starvation for obtaining it from organosulfur compounds. The pathway is required to remediate oxidative stress from chromate, so oscA was discovered by the loss of high resistance to chromate in Pseudomonas corrugata 28 when the gene is insertionally inactivated. The oscA gene tends to be found near sulfate transporter genes. |
| Pubmed ID | 9384377 |
| Domain | CDD:413294 |
| Functional Category | Others |
| Uniprot ID | O31538 |
| ORF Length (Amino Acid) | 55 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 787715 | 787882 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 730167 | 730334 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 770703 | 770870 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 769190 | 769357 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 3229846 | 3230019 | - | NZ_CP011937.1 | Bacillus velezensis |
| 6 | 713589 | 713762 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 7 | 1220333 | 1220500 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 784888 | 785055 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 9 | 2022058 | 2022237 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 10 | 3034109 | 3034261 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 3818848 | 3819015 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03992.18 | 0.73 | 8 | 2270.0 | opposite-strand | Antibiotic biosynthesis monooxygenase |
| 2 | PF00903.27 | 0.73 | 8 | 1830.0 | opposite-strand | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |
| 3 | PF01027.22 | 0.73 | 8 | 113.0 | same-strand | Inhibitor of apoptosis-promoting Bax1 |
| 4 | PF01047.24 | 0.64 | 7 | 984 | opposite-strand | MarR family |
| 5 | PF12802.9 | 0.64 | 7 | 984 | opposite-strand | MarR family |
| 6 | PF01494.21 | 0.64 | 7 | 1637 | same-strand | FAD binding domain |
| 7 | PF13039.8 | 0.64 | 7 | 2931 | opposite-strand | Protein of unknown function (DUF3900) |
| 8 | PF13037.8 | 0.64 | 7 | 2931 | opposite-strand | Domain of unknown function (DUF3898) |
| 9 | PF04239.14 | 0.64 | 7 | 2628 | same-strand | Protein of unknown function (DUF421) |
| 10 | PF01740.23 | 0.64 | 7 | 157 | same-strand | STAS domain |