Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YesK |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 757676 |
Right | 757978 |
Strand | + |
Nucleotide Sequence | TTGTCTTTTTCTAAAAGGGAGGCAGGCGATGTGTGGTCAATATTATTTGTGACAGGGATTGTGACGGCTTGTCTGTTTGCTGGCGTATCCGTATTGATGCGGATGAGATTTCCTGACAAAAGTCGGCCGGAATGGATGTTGGCCGGGCTGATCGTCCTTGGTGTGTTTGCGATCTGGTACAGCCTCGTGTATGTACGCGGCTGGGAAGGGGCTGCGCTCGGAATGCTTGGATTCAATGTCATTTTCGGAGCCATTGCCGGATATTTGATCGATAAGGCCATCCGGCGTTACAGGAAAAGATAA |
Sequence | MSFSKREAGDVWSILFVTGIVTACLFAGVSVLMRMRFPDKSRPEWMLAGLIVLGVFAIWYSLVYVRGWEGAALGMLGFNVIFGAIAGYLIDKAIRRYRKR |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam14150. Profile Description: YesK-like protein. The YesK-like protein family includes the B. subtilis YesK protein, which is functionally uncharacterized. Its expression is regulated by the sporulation-specific sigma factor sigma-E. This family of proteins is found in bacteria. Proteins in this family are approximately 100 amino acids in length. |
Pubmed ID | 9384377 |
Domain | CDD:372929 |
Functional Category | Others |
Uniprot ID | O31514 |
ORF Length (Amino Acid) | 100 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 757676 | 757978 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 951994 | 952236 | + | NZ_CP033052.1 | Bacillus vallismortis |
3 | 726278 | 726580 | + | NZ_CP048852.1 | Bacillus tequilensis |
4 | 740645 | 740887 | + | NZ_CP013984.1 | Bacillus inaquosorum |
5 | 754104 | 754367 | + | NZ_CP051464.1 | Bacillus mojavensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF11007.10 | 1.0 | 5 | 1570 | same-strand | Spore coat associated protein JA (CotJA) |
2 | PF12652.9 | 1.0 | 5 | 1323 | same-strand | CotJB protein |
3 | PF13508.9 | 1.0 | 5 | 71 | same-strand | Acetyltransferase (GNAT) domain |
4 | PF04854.16 | 0.8 | 4 | 115.0 | same-strand | Protein of unknown function, DUF624 |
5 | PF06580.15 | 0.8 | 4 | 740.5 | same-strand | Histidine kinase |
6 | PF02743.20 | 0.8 | 4 | 740.5 | same-strand | Cache domain |
7 | PF00672.27 | 0.8 | 4 | 740.5 | same-strand | HAMP domain |
8 | PF02518.28 | 0.8 | 4 | 740.5 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
9 | PF00072.26 | 0.8 | 4 | 2473.5 | same-strand | Response regulator receiver domain |
10 | PF12833.9 | 0.8 | 4 | 2473.5 | same-strand | Helix-turn-helix domain |
11 | PF00165.25 | 0.8 | 4 | 2473.5 | same-strand | Bacterial regulatory helix-turn-helix proteins, AraC family |
12 | PF13416.8 | 0.8 | 4 | 3683.5 | same-strand | Bacterial extracellular solute-binding protein |
13 | PF01547.27 | 0.8 | 4 | 3683.5 | same-strand | Bacterial extracellular solute-binding protein |
14 | PF00528.24 | 0.8 | 4 | 4963.5 | same-strand | Binding-protein-dependent transport system inner membrane component |
15 | PF14278.8 | 0.6 | 3 | 1892 | same-strand | Transcriptional regulator C-terminal region |
16 | PF00440.25 | 0.6 | 3 | 1892 | same-strand | Bacterial regulatory proteins, tetR family |
17 | PF00583.27 | 0.6 | 3 | 81 | same-strand | Acetyltransferase (GNAT) family |