Protein Information |
Information Type | Description |
---|---|
Protein name | Phosphatase RapI inhibitor (Phosphatase regulator I) |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 548438 |
Right | 548557 |
Strand | + |
Nucleotide Sequence | ATGAAAATCAGCCGGATTCTATTGGCAGCAGTGATTTTAAGTAGTGTATTTTCAATAACTTATTTGCAAAGTGATCATAATACTGAAATTAAAGTTGCTGCAGATCGGGTAGGGGCATAG |
Sequence | MKISRILLAAVILSSVFSITYLQSDHNTEIKVAADRVGA |
Source of smORF | Swiss-Prot |
Function | Inhibitor of the activity of phosphatase RapI. |
Pubmed ID | 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | O31492 |
ORF Length (Amino Acid) | 39 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 548438 | 548557 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 509443 | 509562 | + | NZ_CP048852.1 | Bacillus tequilensis |
3 | 702186 | 702308 | + | NZ_CP033052.1 | Bacillus vallismortis |
4 | 462118 | 462240 | - | NZ_CP033052.1 | Bacillus vallismortis |
5 | 1454526 | 1454654 | - | NZ_CP029364.1 | Bacillus halotolerans |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF18801.3 | 0.75 | 3 | -43.0 | same-strand | response regulator aspartate phosphatase H, N terminal |
2 | PF00515.30 | 0.75 | 3 | -43.0 | same-strand | Tetratricopeptide repeat |