Result : O31492
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Phosphatase RapI inhibitor (Phosphatase regulator I) |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 548438 |
| Right | 548557 |
| Strand | + |
| Nucleotide Sequence | ATGAAAATCAGCCGGATTCTATTGGCAGCAGTGATTTTAAGTAGTGTATTTTCAATAACTTATTTGCAAAGTGATCATAATACTGAAATTAAAGTTGCTGCAGATCGGGTAGGGGCATAG |
| Sequence | MKISRILLAAVILSSVFSITYLQSDHNTEIKVAADRVGA |
| Source of smORF | Swiss-Prot |
| Function | Inhibitor of the activity of phosphatase RapI. |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O31492 |
| ORF Length (Amino Acid) | 39 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 548438 | 548557 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 509443 | 509562 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 702186 | 702308 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 462118 | 462240 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 1454526 | 1454654 | - | NZ_CP029364.1 | Bacillus halotolerans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF18801.3 | 0.75 | 3 | -43.0 | same-strand | response regulator aspartate phosphatase H, N terminal |
| 2 | PF00515.30 | 0.75 | 3 | -43.0 | same-strand | Tetratricopeptide repeat |
++ More..