Result : O31490
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ICEBs1 excisionase (Recombination directionality factor xis) |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 531787 |
| Right | 531981 |
| Strand | + |
| Nucleotide Sequence | TTGAAAGGAGAGTTTTTAACTGCGAGAGATATTCAAAAAATTCTTGGAGTTAAACAGGCTAAATCTTATGACATCATTAGAACTTTGAATGCTCAAATGAAAGAAGAAGGATATATGGTCATTCAAGGTAAGGTGAGTAGAGCTAAGTTTGAAGAGTGTTATTGTTACAAAGGCCCAAAATCTCAAACGGGGTGA |
| Sequence | MKGEFLTARDIQKILGVKQAKSYDIIRTLNAQMKEEGYMVIQGKVSRAKFEECYCYKGPKSQTG |
| Source of smORF | Swiss-Prot |
| Function | Required for the excision of the integrative and conjugative element ICEBs1. Excision of ICEBs1 requires two sites, attL and attR, at the left and right ends of the integrated ICEBs1. {ECO:0000269|Pubmed:18005101}. |
| Pubmed ID | 9384377 18005101 16105942 17511812 |
| Domain | |
| Functional Category | DNA-binding |
| Uniprot ID | O31490 |
| ORF Length (Amino Acid) | 64 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 531787 | 531981 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 686553 | 686747 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 3 | 478239 | 478427 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 3260693 | 3260878 | + | NZ_CP035485.1 | Salicibibacter halophilus |
| 5 | 249946 | 250122 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF10263.11 | 0.75 | 3 | 3214 | same-strand | SprT-like family |
| 2 | PF17283.4 | 0.75 | 3 | 3214 | same-strand | SprT-like zinc ribbon domain |
| 3 | PF00589.24 | 0.75 | 3 | 1178.0 | opposite-strand | Phage integrase family |
| 4 | PF14659.8 | 0.75 | 3 | 1178.0 | opposite-strand | Phage integrase, N-terminal SAM-like domain |
| 5 | PF13102.8 | 0.75 | 3 | 1178.0 | opposite-strand | Phage integrase SAM-like domain |
| 6 | PF06114.15 | 1.0 | 4 | 655 | opposite-strand | IrrE N-terminal-like domain |
| 7 | PF01381.24 | 1.0 | 4 | 274.5 | opposite-strand | Helix-turn-helix |
| 8 | PF12844.9 | 1.0 | 4 | 274.5 | opposite-strand | Helix-turn-helix domain |
| 9 | PF13560.8 | 0.75 | 3 | 274 | opposite-strand | Helix-turn-helix domain |
| 10 | PF06125.13 | 1.0 | 4 | 938 | same-strand | Bacterial protein of unknown function (DUF961) |
| 11 | PF02486.21 | 1.0 | 4 | 2792 | same-strand | Replication initiation factor |
| 12 | PF18106.3 | 1.0 | 4 | 2792 | same-strand | Rolling Circle replication initiation protein N-terminal domain |
++ More..