Result : O31485
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein YdzA |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 475584 |
| Right | 475874 |
| Strand | - |
| Nucleotide Sequence | ATGCTGCACACGCCGATCGGAAGACTTCGCACGATGGGTTTTATTGAAGGAATGTCACTCTTAATCCTGTTGTTCATCGCTATGCCGCTTAAATATTGGGCAGGCCTTCCGCTTGCGGTGACAATTGTCGGTTCGGTTCACGGCGGGTTGTTCATTTTGTATTTGCTTGTCTTGGCTTATGCAACCTTCTCTGTCAAATGGCCGCTGAAATGGTCAGCTGCCGGCTTCATCGCCGCTTTCGTCCCATTCGGAAATTTTTTGTACGACCGCGGATTAAGGAACTATAAATAA |
| Sequence | MLHTPIGRLRTMGFIEGMSLLILLFIAMPLKYWAGLPLAVTIVGSVHGGLFILYLLVLAYATFSVKWPLKWSAAGFIAAFVPFGNFLYDRGLRNYK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl14844. Profile Description: Domain of unknown function (DUF3817). This model describes a strictly bacterial integral membrane domain of about 85 residues in length. It occurs in proteins that on rare occasions are fused to transporter domains such as the major facilitator superfamily domain. Of three invariant residues, two occur as a His-Gly dipeptide in the middle of three predicted transmembrane helices. [Unknown function, General] |
| Pubmed ID | 9384377 |
| Domain | CDD:417503 |
| Functional Category | Others |
| Uniprot ID | O31485 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 52
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 475584 | 475874 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 631868 | 632158 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 3 | 451607 | 451897 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 427525 | 427815 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 472886 | 473176 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 6 | 473809 | 474099 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 1535498 | 1535788 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 3490361 | 3490651 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 463401 | 463691 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 558828 | 559124 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 521317 | 521610 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 12 | 577850 | 578143 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 13 | 468278 | 468574 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 14 | 1066532 | 1066828 | + | NZ_CP043404.1 | Bacillus safensis |
| 15 | 1142055 | 1142351 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 16 | 2014768 | 2015061 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 17 | 3170800 | 3171096 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 18 | 509771 | 510070 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 19 | 2187339 | 2187635 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 20 | 4409577 | 4409906 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 21 | 1509670 | 1509981 | - | NZ_CP013661.2 | Planococcus kocurii |
| 22 | 255639 | 255950 | + | NZ_CP019401.1 | Planococcus faecalis |
| 23 | 10254336 | 10254635 | - | NC_020126.1 | Myxococcus stipitatus DSM 14675 |
| 24 | 9219462 | 9219791 | - | NZ_CP012159.1 | Chondromyces crocatus |
| 25 | 251429 | 251740 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 26 | 264448 | 264759 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 27 | 4151088 | 4151378 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 28 | 6339719 | 6340033 | - | NZ_CP011125.1 | Sandaracinus amylolyticus |
| 29 | 669373 | 669606 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 30 | 239439 | 239750 | + | NZ_CP016540.2 | Planococcus versutus |
| 31 | 4925500 | 4925808 | - | NZ_CP011390.1 | Flavisolibacter tropicus |
| 32 | 4141916 | 4142197 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 33 | 2593057 | 2593353 | - | NZ_CP009621.1 | Pontibacter korlensis |
| 34 | 6926034 | 6926360 | + | NZ_CP036274.1 | Anatilimnocola aggregata |
| 35 | 927369 | 927650 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 36 | 3181274 | 3181594 | - | NZ_CP014766.1 | Pontibacter akesuensis |
| 37 | 1832611 | 1832901 | + | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 38 | 3338385 | 3338669 | + | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 39 | 5620847 | 5621140 | - | NC_015703.1 | Runella slithyformis DSM 19594 |
| 40 | 2935700 | 2935996 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 41 | 287817 | 288101 | + | NZ_CP013909.1 | Hymenobacter sedentarius |
| 42 | 4800932 | 4801249 | + | NZ_CP022163.1 | Melittangium boletus DSM 14713 |
| 43 | 2029301 | 2029609 | - | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 44 | 12325134 | 12325373 | - | NC_010162.1 | Sorangium cellulosum So ce56 |
| 45 | 2821164 | 2821445 | + | NZ_AP019400.1 | Cohnella abietis |
| 46 | 1805020 | 1805307 | - | NZ_CP044285.1 | Hymenobacter baengnokdamensis |
| 47 | 3482045 | 3482323 | + | NC_017030.1 | Corallococcus coralloides DSM 2259 |
| 48 | 1415563 | 1415853 | + | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 49 | 3970314 | 3970559 | + | NZ_CP037922.1 | Hymenobacter radiodurans |
| 50 | 2311359 | 2311646 | + | NZ_CP032317.1 | Hymenobacter oligotrophus |
| 51 | 1617133 | 1617441 | + | NZ_CP030944.1 | Arcobacter aquimarinus |
| 52 | 1584863 | 1585171 | + | NZ_CP053833.1 | Arcobacter cloacae |
++ More..