Result : O31479
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YczF |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 419763 |
| Right | 419984 |
| Strand | - |
| Nucleotide Sequence | ATGAAGATATTGGGCGTGACCGGATTCATATTAATTTGTTTATTAGCTATTTCTGTGTTGATGGACATGCTTCAAGGGTTCAGTTTAACAAAAGCCGTTTATAACAATATGTCCAGCTTTAAGATGACAACATTTGCGGAATGGGTCGTGCTTTTATTTTTTGTGTTAGTACTTGTGAGAGAAATGTACGTGATCTATAAATCGAAAAAAAAGAACCCCTAA |
| Sequence | MKILGVTGFILICLLAISVLMDMLQGFSLTKAVYNNMSSFKMTTFAEWVVLLFFVLVLVREMYVIYKSKKKNP |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O31479 |
| ORF Length (Amino Acid) | 73 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 419763 | 419984 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 417213 | 417434 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 400087 | 400308 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 372666 | 372887 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 418185 | 418406 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 575768 | 576001 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 7 | 1591301 | 1591522 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 3549864 | 3550085 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 403966 | 404187 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00854.23 | 1.0 | 9 | 2050 | same-strand | POT family |
| 2 | PF07690.18 | 1.0 | 9 | 2050 | same-strand | Major Facilitator Superfamily |
| 3 | PF13229.8 | 1.0 | 9 | 16 | opposite-strand | Right handed beta helix region |
| 4 | PF03323.15 | 1.0 | 9 | 126 | opposite-strand | Bacillus/Clostridium GerA spore germination protein |
| 5 | PF05504.13 | 1.0 | 9 | 1749 | opposite-strand | Spore germination B3/ GerAC like, C-terminal |
| 6 | PF03845.15 | 1.0 | 9 | 2998 | opposite-strand | Spore germination protein |
| 7 | PF00005.29 | 0.67 | 6 | 4224.5 | same-strand | ABC transporter |
| 8 | PF02687.23 | 0.67 | 6 | 4920.5 | same-strand | FtsX-like permease family |
++ More..