Result : O31466
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Tryptophan RNA-binding attenuator protein inhibitory protein (Anti-TRAP protein) (AT) |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 277160 |
| Right | 277321 |
| Strand | + |
| Nucleotide Sequence | ATGGTCATTGCAACTGATGATCTTGAGGTCGCATGTCCTAAATGTGAAAGAGCGGGAGAAATCGAAGGAACACCTTGCCCGGCCTGCAGCGGAAAAGGTGTTATTCTGACTGCTCAAGGATATACGCTTCTCGATTTTATCCAAAAGCATTTGAATAAGTAA |
| Sequence | MVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK |
| Source of smORF | Swiss-Prot |
| Function | By forming a complex with tryptophan-activated TRAP, and masking its RNA binding site, it inhibits TRAP's RNA binding ability, thereby abolishing TRAP regulation of gene expression, leading to antitermination and increased trp operon expression. AT acts by competing with messenger RNA for the RNA binding domain of TRAP. |
| Pubmed ID | 9384377 11557884 11786553 |
| Domain | CDD:417755 |
| Functional Category | Others |
| Uniprot ID | O31466 |
| ORF Length (Amino Acid) | 53 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 277160 | 277321 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 237390 | 237551 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 261042 | 261203 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 1741108 | 1741269 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 5 | 269267 | 269428 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 282162 | 282323 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 7 | 287562 | 287726 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 8 | 342956 | 343117 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 9 | 3672834 | 3672998 | - | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 315260 | 315421 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 2766945 | 2767115 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 12 | 1939276 | 1939449 | + | NZ_CP045293.1 | Paenibacillus guangzhouensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 0.67 | 8 | 2727.5 | same-strand | ABC transporter |
| 2 | PF12730.9 | 0.67 | 8 | 3528.0 | same-strand | ABC-2 family transporter protein |
++ More..