Result : O31460
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein YbgB |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 258532 |
| Right | 258807 |
| Strand | + |
| Nucleotide Sequence | ATGTTTTTATTTACGAATGGAAAAGTGCTGTGGGGAGCAGTGATTGCTGCATTCATCCTTTCAATTGTATTTTACCCTTTTCTGCCGACGCAGATGCCGATTCATTATGATGTTGCGAACAGTCCGGATCTGACGGTTAACAAGCTGGCGGGGACTGTGATGCTGCCTGTTTTGATGGTGGTGTTTGCATGGGCGCGGAAGATCAATTGGCAATTTGTATTCGCAGTGTATATTTTGCTGATTTGCCACATTGTCGTCCTTTGTTTAGCGCTCTAA |
| Sequence | MFLFTNGKVLWGAVIAAFILSIVFYPFLPTQMPIHYDVANSPDLTVNKLAGTVMLPVLMVVFAWARKINWQFVFAVYILLICHIVVLCLAL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam07853. Profile Description: Protein of unknown function (DUF1648). Members of this family are hypothetical proteins expressed by either bacterial or archaeal species. Some of these are annotated as being transmembrane proteins, and in fact many of these sequences contain a high proportion of hydrophobic residues. |
| Pubmed ID | 9384377 12897008 |
| Domain | CDD:400280 |
| Functional Category | Others |
| Uniprot ID | O31460 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 258532 | 258807 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 250259 | 250534 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 3155507 | 3155779 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 218761 | 219036 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 257339 | 257614 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 6 | 392510 | 392785 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 7 | 250618 | 250893 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 1759643 | 1759918 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 9 | 837372 | 837644 | - | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 3144156 | 3144428 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF17773.3 | 0.67 | 6 | 5059.5 | same-strand | UPF0176 acylphosphatase like domain |
| 2 | PF12368.10 | 0.67 | 6 | 5059.5 | same-strand | Rhodanase C-terminal |
| 3 | PF00581.22 | 0.67 | 6 | 5059.5 | same-strand | Rhodanese-like domain |
| 4 | PF00375.20 | 0.67 | 6 | 3769.0 | opposite-strand | Sodium:dicarboxylate symporter family |
| 5 | PF02378.20 | 0.78 | 7 | 1730 | opposite-strand | Phosphotransferase system, EIIC |
| 6 | PF00358.22 | 0.78 | 7 | 1730 | opposite-strand | phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1 |
| 7 | PF00367.22 | 0.78 | 7 | 1730 | opposite-strand | phosphotransferase system, EIIB |
| 8 | PF01182.22 | 0.78 | 7 | 960 | opposite-strand | Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase |
| 9 | PF07702.15 | 0.78 | 7 | 34 | same-strand | UTRA domain |
| 10 | PF00392.23 | 0.78 | 7 | 34 | same-strand | Bacterial regulatory proteins, gntR family |
| 11 | PF01063.21 | 0.78 | 7 | 202 | same-strand | Amino-transferase class IV |
| 12 | PF00324.23 | 0.78 | 7 | 1316 | opposite-strand | Amino acid permease |
| 13 | PF13520.8 | 0.78 | 7 | 1316 | opposite-strand | Amino acid permease |
| 14 | PF02574.18 | 0.78 | 7 | 2849 | opposite-strand | Homocysteine S-methyltransferase |
| 15 | PF01235.19 | 0.78 | 7 | 3925 | opposite-strand | Sodium:alanine symporter family |
| 16 | PF04960.17 | 0.78 | 7 | 5384 | opposite-strand | Glutaminase |
++ More..