Result : O31442
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YbeF |
| NCBI Accession ID | AB006424.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 38615 |
| Right | 38863 |
| Strand | + |
| Nucleotide Sequence | ATGGATGAATTAGATATCGCATTCTTTATTTTACCGTTAGGAATTATGCTGCTATCGATTGTCGGGACCTGTATTTGTAAAAACCCGTATCTGATGCCAATGCTTAGTTTGGTGATTTCTCTTGTGCTCACCTTTACCATTTTTAATCAATCATTTTTGGGATGGGCTGTTGTCTATAGCTTGGTTTCTCTGGCTTTATCCTATATCACATTGATTGTGGTAAGGAAAAGGAAGGAATCAGGAAATTAA |
| Sequence | MDELDIAFFILPLGIMLLSIVGTCICKNPYLMPMLSLVISLVLTFTIFNQSFLGWAVVYSLVSLALSYITLIVVRKRKESGN |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10852. Profile Description: Protein of unknown function (DUF2651). This family of proteins with unknown function appears to be restricted to Bacillus spp. |
| Pubmed ID | 9384377 |
| Domain | CDD:371270 |
| Functional Category | Others |
| Uniprot ID | O31442 |
| ORF Length (Amino Acid) | 82 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 235625 | 235873 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 198617 | 198865 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 228935 | 229183 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 237566 | 237814 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 1781175 | 1781423 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 371083 | 371331 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 7 | 230582 | 230830 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 263517 | 263747 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 3700986 | 3701216 | - | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 3704062 | 3704310 | - | NZ_CP011937.1 | Bacillus velezensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13520.8 | 0.78 | 7 | 2658 | same-strand | Amino acid permease |
| 2 | PF00324.23 | 0.78 | 7 | 2658 | same-strand | Amino acid permease |
| 3 | PF03009.19 | 1.0 | 9 | 1722.5 | opposite-strand | Glycerophosphoryl diester phosphodiesterase family |
| 4 | PF07690.18 | 1.0 | 9 | 295.5 | opposite-strand | Major Facilitator Superfamily |
| 5 | PF00583.27 | 0.78 | 7 | 92 | same-strand | Acetyltransferase (GNAT) family |
| 6 | PF01047.24 | 0.78 | 7 | 92 | same-strand | MarR family |
| 7 | PF13508.9 | 0.78 | 7 | 92 | same-strand | Acetyltransferase (GNAT) domain |
| 8 | PF12802.9 | 0.78 | 7 | 92 | same-strand | MarR family |
| 9 | PF13412.8 | 0.78 | 7 | 92 | same-strand | Winged helix-turn-helix DNA-binding |
| 10 | PF06779.16 | 0.78 | 7 | 1006 | same-strand | Uncharacterised MFS-type transporter YbfB |
++ More..