Result : A0A089QKZ7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein Rv1155A |
| NCBI Accession ID | CP009480.1 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 1278651 |
| Right | 1278839 |
| Strand | + |
| Nucleotide Sequence | ATGGGTGAATCGAAGTCCCCGCAAGAGTCCAGCTCAGAGGGTGAGACCAAGCGCAAGTTCCGGGAAGCCCTCGACCGCAAGATGGCACAGTCGTCGAGCGGATCCGATCATAAGGATGGCGGCGGCAAGCAGTCGCGGGCGCACGGTCCGGTGGCGAGCCGTCGGGAATTCCGCCGCAAGAGCGGCTAG |
| Sequence | MGESKSPQESSSEGETKRKFREALDRKMAQSSSGSDHKDGGGKQSRAHGPVASRREFRRKSG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17227. Profile Description: Family of unknown function (DUF5302). Family of unknown function found in Actinobacteria with highly conserved motif of FRRKSG found at the C-terminus. |
| Pubmed ID | 9634230 21969609 |
| Domain | CDD:407345 |
| Functional Category | Others |
| Uniprot ID | A0A089QKZ7 |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 84
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1282030 | 1282218 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 1302143 | 1302331 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 787864 | 788052 | + | NZ_AP022581.1 | Mycobacterium lacus |
| 4 | 2874041 | 2874229 | - | NZ_AP022582.1 | Mycobacterium seoulense |
| 5 | 3207548 | 3207763 | - | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 6 | 1674424 | 1674597 | - | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 7 | 1425068 | 1425256 | - | NZ_AP022572.1 | Mycobacterium shottsii |
| 8 | 4840442 | 4840630 | - | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 9 | 122160 | 122348 | - | NZ_CP058277.1 | Mycobacterium marinum |
| 10 | 2807127 | 2807315 | - | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 11 | 392950 | 393123 | + | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 12 | 634182 | 634370 | - | NZ_AP022583.1 | Mycobacterium noviomagense |
| 13 | 105639 | 105824 | + | NZ_AP022614.1 | Mycobacterium parmense |
| 14 | 4313312 | 4313500 | - | NZ_LR130759.1 | Mycobacterium basiliense |
| 15 | 5272241 | 5272432 | - | NZ_CP025546.1 | Mycobacterium paragordonae |
| 16 | 2944265 | 2944438 | + | NZ_AP022589.1 | Mycolicibacter minnesotensis |
| 17 | 4492415 | 4492612 | - | NZ_AP022613.1 | Mycobacterium conspicuum |
| 18 | 2721268 | 2721426 | + | NZ_AP022606.1 | Mycobacterium branderi |
| 19 | 2310753 | 2310938 | - | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 20 | 1418336 | 1418524 | + | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 21 | 4131197 | 4131388 | - | NZ_AP018164.1 | Mycobacterium shigaense |
| 22 | 768761 | 768934 | - | NZ_AP022562.1 | Mycobacterium novum |
| 23 | 1214028 | 1214201 | + | NC_015576.1 | Mycolicibacter sinensis |
| 24 | 684008 | 684181 | + | NZ_AP022609.1 | Mycolicibacter hiberniae |
| 25 | 3315337 | 3315513 | + | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 26 | 5348381 | 5348548 | + | NZ_AP022608.1 | Mycolicibacterium gadium |
| 27 | 4022659 | 4022853 | + | NZ_AP022568.1 | Mycobacterium simiae |
| 28 | 3013767 | 3013934 | - | NZ_AP022601.1 | Mycobacterium gallinarum |
| 29 | 4868350 | 4868532 | - | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 30 | 2026885 | 2027052 | + | NZ_AP022560.1 | Mycolicibacterium moriokaense |
| 31 | 411956 | 412129 | - | NZ_AP022600.1 | Mycolicibacterium tokaiense |
| 32 | 1805979 | 1806149 | + | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 33 | 4723042 | 4723212 | - | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 34 | 870646 | 870819 | + | NZ_AP022612.1 | Mycolicibacterium confluentis |
| 35 | 3621016 | 3621186 | + | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 36 | 2769923 | 2770099 | - | NZ_AP022620.1 | Mycolicibacterium anyangense |
| 37 | 2898939 | 2899109 | + | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 38 | 5005154 | 5005360 | + | NZ_AP022576.1 | Mycobacterium florentinum |
| 39 | 4906721 | 4906903 | - | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 40 | 1124027 | 1124185 | + | NZ_LR134355.1 | Mycolicibacterium chitae |
| 41 | 1141614 | 1141787 | + | NZ_LT906469.1 | Mycolicibacter terrae |
| 42 | 501291 | 501458 | - | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 43 | 3107049 | 3107219 | + | NZ_CP012150.1 | Mycobacterium goodii |
| 44 | 1887711 | 1887899 | - | NC_021252.1 | Amycolatopsis keratiniphila |
| 45 | 6530008 | 6530196 | + | NZ_CP008953.1 | Amycolatopsis japonica |
| 46 | 5069976 | 5070134 | + | NZ_AP022565.1 | Mycolicibacterium alvei |
| 47 | 5282820 | 5282990 | - | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 48 | 5685537 | 5685716 | - | NZ_AP022588.1 | Mycolicibacterium sediminis |
| 49 | 4468255 | 4468431 | - | NZ_AP022561.1 | Mycolicibacterium aichiense |
| 50 | 4563817 | 4564002 | - | NZ_LR134356.1 | Mycolicibacterium aurum |
| 51 | 1014524 | 1014700 | - | NZ_AP022596.1 | Mycolicibacterium helvum |
| 52 | 227790 | 227957 | + | NZ_AP022586.1 | Mycolicibacterium litorale |
| 53 | 7441969 | 7442157 | + | NZ_CP016174.1 | Amycolatopsis orientalis |
| 54 | 2656312 | 2656488 | + | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 55 | 1151245 | 1151433 | + | NZ_CP062008.1 | Mycolicibacterium mucogenicum DSM 44124 |
| 56 | 7698531 | 7698716 | + | NC_022116.1 | Amycolatopsis mediterranei RB |
| 57 | 2622767 | 2622955 | - | NZ_AP022616.1 | Mycolicibacterium phocaicum |
| 58 | 2884882 | 2885067 | + | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 59 | 2285908 | 2286099 | + | NZ_AP022574.1 | Mycolicibacterium psychrotolerans |
| 60 | 5214500 | 5214667 | + | NZ_AP022593.1 | Mycolicibacterium arabiense |
| 61 | 3952523 | 3952681 | - | NZ_AP022603.1 | Mycolicibacterium fallax |
| 62 | 4036552 | 4036710 | + | NZ_AP022618.1 | Mycolicibacterium insubricum |
| 63 | 136874 | 137053 | + | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 64 | 1282550 | 1282735 | + | NZ_CP014955.1 | Mycobacteroides abscessus |
| 65 | 2483290 | 2483487 | - | NZ_AP023172.1 | Rhodococcus qingshengii |
| 66 | 8178354 | 8178542 | - | NZ_CP015163.1 | Amycolatopsis albispora |
| 67 | 4531789 | 4531974 | - | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 68 | 1144947 | 1145132 | + | NZ_CP010271.1 | Mycobacteroides saopaulense |
| 69 | 1257406 | 1257591 | + | NZ_CP007220.1 | Mycobacteroides chelonae CCUG 47445 |
| 70 | 2909564 | 2909731 | - | NZ_AP022605.1 | Mycobacterium doricum |
| 71 | 1392844 | 1393029 | + | NZ_CP011530.1 | Mycobacteroides immunogenum |
| 72 | 294098 | 294283 | - | NC_015635.1 | Microlunatus phosphovorus NM-1 |
| 73 | 4446515 | 4446685 | - | NZ_AP022610.1 | Mycolicibacterium madagascariense |
| 74 | 308022 | 308195 | + | NZ_AP022617.1 | Mycolicibacterium monacense |
| 75 | 1257786 | 1257971 | - | NZ_CP044232.1 | Microbacterium lushaniae |
| 76 | 4558827 | 4559015 | + | NZ_AP022577.1 | Mycolicibacterium aubagnense |
| 77 | 1299098 | 1299283 | - | NZ_CP038266.1 | Microbacterium wangchenii |
| 78 | 3536307 | 3536474 | + | NZ_CP027793.1 | Rhodococcus hoagii |
| 79 | 91719 | 91892 | + | NZ_CP061344.1 | Microbacterium hominis |
| 80 | 4302254 | 4302448 | - | NC_013595.1 | Streptosporangium roseum DSM 43021 |
| 81 | 1235303 | 1235488 | + | NZ_AP018165.1 | [Mycobacterium] stephanolepidis |
| 82 | 2194841 | 2195017 | + | NZ_CP031422.1 | Microbacterium oxydans |
| 83 | 1530752 | 1530928 | - | NZ_CP031425.1 | Microbacterium foliorum |
| 84 | 3588718 | 3588915 | - | NZ_CP011112.1 | Luteipulveratus mongoliensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00392.23 | 0.61 | 51 | 1899 | same-strand | Bacterial regulatory proteins, gntR family |
| 2 | PF14502.8 | 0.62 | 52 | 1899.5 | same-strand | Helix-turn-helix domain |
| 3 | PF04072.16 | 0.65 | 55 | 1055 | opposite-strand | Leucine carboxyl methyltransferase |
| 4 | PF08002.13 | 0.7 | 59 | 543 | opposite-strand | Protein of unknown function (DUF1697) |
| 5 | PF01243.22 | 0.79 | 66 | 30.5 | same-strand | Pyridoxamine 5'-phosphate oxidase |
++ More..